Recombinant Human SLAMF8 Protein, His-tagged

• Cat.No.: SLAMF8-726H
• Product Overview: Recombinant Human SLAMF8(Ala23-Asp233) fused with His tag at the C-terminus was produced in HEK293.

Specification

• Description: SLAM family member 8(SLAMF8) is a single-pass type I membrane protein and contains 1 Ig-like C2-type (immunoglobulin-like) domain. SLAMF8 encodes a member of the CD2 family of cell surface proteins involved in lymphocyte activation. These proteins are characterized by Ig domains. The protein is expressed in lymphoid tissues, and studies of a similar protein in mouse suggest that it may function during B cell lineage commitment.
• Source: HEK293
• Species: Human
• Tag: His
• Form: Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.
• Protein length: Ala23-Asp233
• AA sequence: AQVLSKVGGSVLLVAARPPGFQVREAIWRSLWPSEELLATFFRGSLETLYHSRFLGRAQLHSNLS LELGPLESGDSGNFSVLMVDTRGQPWTQTLQLKVYDAVPRPVVQVFIAVERDAQPSKTCQVFLSC WAPNISEITYSWRRETTMDFGMEPHSLFTDGQVLSISLGPGDRDVAYSCIVSNPVSWDLATVTPW DSCHHEAAPGKASYKDVDHHHHHH
• Endotoxin: Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
• Purity: Greater than 95% as determined by reducing SDS-PAGE.
• Storage: Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.
  Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.
  Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
• Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
  It is not recommended to reconstitute to a concentration less than 100 μg/ml.
  Dissolve the lyophilized protein in ddH2O.
  Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• Shipping: The product is shipped at ambient temperature.

Gene Information

• Gene Name: SLAMF8 SLAM family member 8 [ Homo sapiens ]
• Official Symbol: SLAMF8
• Synonyms: SLAMF8; SLAM family member 8; BLAME; CD353; SBBI42; BCM-like membrane protein; B lymphocyte activator macrophage expressed; B-lymphocyte activator macrophage expressed; FLJ20442; MGC129578
• Gene ID: 56833
• mRNA Refseq: NM_020125
• Protein Refseq: NP_064510
• MIM: 606620
• UniProt ID: Q9P0V8