Recombinant Human SLAMF8 Protein, His-tagged
Cat.No. : | SLAMF8-726H |
Product Overview : | Recombinant Human SLAMF8(Ala23-Asp233) fused with His tag at the C-terminus was produced in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | Ala23-Asp233 |
Description : | SLAM family member 8(SLAMF8) is a single-pass type I membrane protein and contains 1 Ig-like C2-type (immunoglobulin-like) domain. SLAMF8 encodes a member of the CD2 family of cell surface proteins involved in lymphocyte activation. These proteins are characterized by Ig domains. The protein is expressed in lymphoid tissues, and studies of a similar protein in mouse suggest that it may function during B cell lineage commitment. |
Form : | Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4. |
AA sequence : | AQVLSKVGGSVLLVAARPPGFQVREAIWRSLWPSEELLATFFRGSLETLYHSRFLGRAQLHSNLS LELGPLESGDSGNFSVLMVDTRGQPWTQTLQLKVYDAVPRPVVQVFIAVERDAQPSKTCQVFLSC WAPNISEITYSWRRETTMDFGMEPHSLFTDGQVLSISLGPGDRDVAYSCIVSNPVSWDLATVTPW DSCHHEAAPGKASYKDVDHHHHHH |
Endotoxin : | Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test. |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Storage : | Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days. Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months. |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Shipping : | The product is shipped at ambient temperature. |
Gene Name | SLAMF8 SLAM family member 8 [ Homo sapiens ] |
Official Symbol | SLAMF8 |
Synonyms | SLAMF8; SLAM family member 8; BLAME; CD353; SBBI42; BCM-like membrane protein; B lymphocyte activator macrophage expressed; B-lymphocyte activator macrophage expressed; FLJ20442; MGC129578; |
Gene ID | 56833 |
mRNA Refseq | NM_020125 |
Protein Refseq | NP_064510 |
MIM | 606620 |
UniProt ID | Q9P0V8 |
◆ Recombinant Proteins | ||
Slamf8-1595H | Recombinant Human Slamf8 Protein (Ala23-Asp233), C-His tagged | +Inquiry |
SLAMF8-689H | Active Recombinant Human SLAMF8, Fc-tagged, Biotinylated | +Inquiry |
SLAMF8-5027H | Recombinant Human SLAMF8 Protein (Met1-Asp233), C-His tagged | +Inquiry |
Slamf8-4063M | Recombinant Mouse Slamf8 protein(Met1-Asp231), His-tagged | +Inquiry |
SLAMF8-2694H | Recombinant Human SLAMF8, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLAMF8-2093MCL | Recombinant Mouse SLAMF8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SLAMF8 Products
Required fields are marked with *
My Review for All SLAMF8 Products
Required fields are marked with *
0
Inquiry Basket