Active Recombinant Human SLAMF8, Fc-tagged, Biotinylated

• Cat.No.: SLAMF8-689H
• Product Overview: The recombinant human SLAMF8-Fc fusion protein is expressed as a 440-amino acid protein consisting of Ala23 - Val234 region of SLAMF8 (UniProt accession #Q9P0V8) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.

Specification

• Source: Human cells
• Species: Human
• Tag: Fc
• Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
• Bio-activity: Immobilized SLAMF8 interacts homophilically with SLAMF8 in a functional ELISA
• Molecular Mass: Calculated molecular mass (kDa): 49.1; Estimated by SDS-PAGE under reducing condition (kDa): 65-75
• AA Sequence: AQVLSKVGGSVLLVAARPPGFQVREAIWRSLWPSEELLATFFRGSLETLYHSRFLGRAQLHSNLSLELGPLESG DSGNFSVLMVDTRGQPWTQTLQLKVYDAVPRPVVQVFIAVERDAQPSKTCQVFLSCWAPNISEITYSWRRETTM DFGMEPHSLFTDGQVLSISLGPGDRDVAYSCIVSNPVSWDLATVTPWDSCHHEAAPGKASYKDVSTGTHTCPPC PAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVV SVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDI AVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
• Endotoxin: <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">
• Purity: >95% judged by SDS-PAGE under reducing condition
• Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
• Protein length: 23-234 a.a.

Gene Information

• Gene Name: SLAMF8 SLAM family member 8 [ Homo sapiens ]
• Official Symbol: SLAMF8
• Synonyms: SLAMF8; SLAM family member 8; BLAME; CD353; SBBI42; BCM-like membrane protein; B lymphocyte activator macrophage expressed; B-lymphocyte activator macrophage expressed; FLJ20442; MGC129578
• Gene ID: 56833
• mRNA Refseq: NM_020125
• Protein Refseq: NP_064510
• MIM: 606620
• UniProt ID: Q9P0V8
• Chromosome Location: 1q23.1
• Function: receptor activity