Active Recombinant Human SLAMF8, Fc-tagged, Biotinylated

Cat.No. : SLAMF8-689H
Product Overview : The recombinant human SLAMF8-Fc fusion protein is expressed as a 440-amino acid protein consisting of Ala23 - Val234 region of SLAMF8 (UniProt accession #Q9P0V8) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human Cells
Tag : Fc
Protein Length : 23-234 a.a.
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity : Immobilized SLAMF8 interacts homophilically with SLAMF8 in a functional ELISA
Molecular Mass : Calculated molecular mass (kDa): 49.1; Estimated by SDS-PAGE under reducing condition (kDa): 65-75
AA Sequence : AQVLSKVGGSVLLVAARPPGFQVREAIWRSLWPSEELLATFFRGSLETLYHSRFLGRAQLHSNLSLELGPLESG DSGNFSVLMVDTRGQPWTQTLQLKVYDAVPRPVVQVFIAVERDAQPSKTCQVFLSCWAPNISEITYSWRRETTM DFGMEPHSLFTDGQVLSISLGPGDRDVAYSCIVSNPVSWDLATVTPWDSCHHEAAPGKASYKDVSTGTHTCPPC PAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVV SVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDI AVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin : <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name SLAMF8 SLAM family member 8 [ Homo sapiens ]
Official Symbol SLAMF8
Synonyms SLAMF8; SLAM family member 8; BLAME; CD353; SBBI42; BCM-like membrane protein; B lymphocyte activator macrophage expressed; B-lymphocyte activator macrophage expressed; FLJ20442; MGC129578;
Gene ID 56833
mRNA Refseq NM_020125
Protein Refseq NP_064510
MIM 606620
UniProt ID Q9P0V8
Chromosome Location 1q23.1
Function receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SLAMF8 Products

Required fields are marked with *

My Review for All SLAMF8 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon