Active Recombinant Human SLAMF8, Fc-tagged
Cat.No. : | SLAMF8-690H |
Product Overview : | The recombinant human SLAMF8-Fc fusion protein is expressed as a 440-amino acid protein consisting of Ala23 - Val234 region of SLAMF8 (UniProt accession #Q9P0V8) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions. |
- Specification
- Gene Information
- Related Products
- Download
Source : | Human cells |
Species : | Human |
Tag : | Fc |
Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). |
Bio-activity : | Immobilized SLAMF8 interacts homophilically with SLAMF8 in a functional ELISA |
Molecular Mass : | Calculated molecular mass (kDa): 49.1; Estimated by SDS-PAGE under reducing condition (kDa): 65-75 |
AA Sequence : | AQVLSKVGGSVLLVAARPPGFQVREAIWRSLWPSEELLATFFRGSLETLYHSRFLGRAQLHSNLSLELGPLESG DSGNFSVLMVDTRGQPWTQTLQLKVYDAVPRPVVQVFIAVERDAQPSKTCQVFLSCWAPNISEITYSWRRETTM DFGMEPHSLFTDGQVLSISLGPGDRDVAYSCIVSNPVSWDLATVTPWDSCHHEAAPGKASYKDVSTGTHTCPPC PAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVV SVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDI AVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin : | <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">0.1> |
Purity : | >95% judged by SDS-PAGE under reducing condition |
Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
Protein length : | 23-234 a.a. |
Gene Name | SLAMF8 SLAM family member 8 [ Homo sapiens ] |
Official Symbol | SLAMF8 |
Synonyms | SLAMF8; SLAM family member 8; BLAME; CD353; SBBI42; BCM-like membrane protein; B lymphocyte activator macrophage expressed; B-lymphocyte activator macrophage expressed; FLJ20442; MGC129578; |
Gene ID | 56833 |
mRNA Refseq | NM_020125 |
Protein Refseq | NP_064510 |
MIM | 606620 |
UniProt ID | Q9P0V8 |
Chromosome Location | 1q23.1 |
Function | receptor activity; |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All SLAMF8 Products
Required fields are marked with *
My Review for All SLAMF8 Products
Required fields are marked with *
0
Inquiry Basket