Recombinant Human SKAP1 protein, His-SUMO-tagged

• Cat.No.: SKAP1-4587H
• Product Overview: Recombinant Human SKAP1 protein(Q86WV1)(1-358aa), fused to N-terminal His-SUMO tag, was expressed in E. coli

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 1-358aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 57.3 kDa
• AA Sequence: MQAAALPEEIRWLLEDAEEFLAEGLRNENLSAVARDHRDHILRGFQQIKARYYWDFQPQGGDIGQDSSDDNHSGTLGLSLTSDAPFLSDYQDEGMEDIVKGAQELDNVIKQGYLEKKSKDHSFFGSEWQKRWCVVSRGLFYYYANEKSKQPKGTFLIKGYGVRMAPHLRRDSKKESCFELTSQDRRSYEFTATSPAEARDWVDQISFLLKDLSSLTIPYEEDEEEEEKEETYDDIDGFDSPSCGSQCRPTILPGSVGIKEPTEEKEEEDIYEVLPDEEHDLEEDESGTRRKGVDYASYYQGLWDCHGDQPDELSFQRGDLIRILSKEYNMYGWWVGELNSLVGIVPKEYLTTAFEVEE
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: SKAP1 src kinase associated phosphoprotein 1 [ Homo sapiens ]
• Official Symbol: SKAP1
• Synonyms: SKAP1; src kinase associated phosphoprotein 1; SCAP1, src family associated phosphoprotein 1; src kinase-associated phosphoprotein 1; SKAP55; pp55; SKAP-55; src family associated phosphoprotein 1; src family-associated phosphoprotein 1; src kinase-associated phosphoprotein of 55 kDa; SCAP1
• Gene ID: 8631
• mRNA Refseq: NM_001075099
• Protein Refseq: NP_001068567
• MIM: 604969
• UniProt ID: Q86WV1