Recombinant Human SIRT4
Cat.No. : | SIRT4-30846TH |
Product Overview : | Recombinant full length Human SIRT4 with an N terminal proprietary tag; predicted MWt 62 kDa inclusive of tag; |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 314 amino acids |
Description : | This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class IV of the sirtuin family. |
Molecular Weight : | 62.000kDa inclusive of tags |
Tissue specificity : | Detected in vascular smooth muscle and striated muscle. Detected in insulin-producing beta-cells in pancreas islets of Langerhans (at protein level). Widely expressed. Weakly expressed in leukocytes and fetal thymus. |
Form : | Liquid |
Purity : | by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 25% Glycerol, 50mM Tris HCl, 150mM Sodium chloride, 10mM Glutathione, 0.25mM DTT, 0.1mM EDTA, 0.1mM PMSF, pH 7.5 |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MKMSFALTFRSAKGRWIANPSQPCSKASIGLFVPASPPLDPEKVKELQRFITLSKRLLVMTGAGISTESGIPDYRSEKVGLYARTDRRPIQHGDFVRSAPIRQRYWARNFVGWPQFSSHQPNPAHWALSTWEKLGKLYWLVTQNVDALHTKAGSRRLTELHGCMDRVLCLDCGEQTPRGVLQERFQVLNPTWSAEAHGLAPDGDVFLSEEQVRSFQVPTCVQCGGHLKPDVVFFGDTVNPDKVDFVHKRVKEADSLLVVGSSLQVYSGYRFILTAWEKKLPIAILNIGPTRSDDLACLKLNSRCGELLPLIDPC |
Sequence Similarities : | Belongs to the sirtuin family.Contains 1 deacetylase sirtuin-type domain. |
Gene Name | SIRT4 sirtuin 4 [ Homo sapiens ] |
Official Symbol | SIRT4 |
Synonyms | SIRT4; sirtuin 4; sirtuin (silent mating type information regulation 2 homolog) 4 (S. cerevisiae) , sirtuin (silent mating type information regulation 2, S. cerevisiae, homolog) 4; NAD-dependent ADP-ribosyltransferase sirtuin-4; SIR2L4; |
Gene ID | 23409 |
mRNA Refseq | NM_012240 |
Protein Refseq | NP_036372 |
MIM | 604482 |
Uniprot ID | Q9Y6E7 |
Chromosome Location | 12q24.31 |
Pathway | Signaling events mediated by HDAC Class I, organism-specific biosystem; |
Function | NAD+ ADP-ribosyltransferase activity; NAD+ ADP-ribosyltransferase activity; NAD+ binding; NOT NAD-dependent protein deacetylase activity; metal ion binding; |
◆ Recombinant Proteins | ||
SIRT4-30846TH | Recombinant Human SIRT4 | +Inquiry |
SIRT4-024H | Recombinant Full Length Human SIRT4 Protein, GST-tagged | +Inquiry |
SIRT4-25H | Recombinant Human SIRT4 protein, His-tagged | +Inquiry |
SIRT4-111H | Recombinant Human SIRT4 Protein, GST-tagged | +Inquiry |
SIRT4-8182M | Recombinant Mouse SIRT4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SIRT4-1831HCL | Recombinant Human SIRT4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SIRT4 Products
Required fields are marked with *
My Review for All SIRT4 Products
Required fields are marked with *
0
Inquiry Basket