Recombinant Human signal transducer and activator of transcription 2, 113kDa Protein, His tagged

• Cat.No.: STAT2-01H
• Product Overview: Recombinant Human STAT2 Protein (679-851aa) with C-His tag was expressed in E. coli.

Specification

• Description: The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. In response to interferon (IFN), this protein forms a complex with STAT1 and IFN regulatory factor family protein p48 (ISGF3G), in which this protein acts as a transactivator, but lacks the ability to bind DNA directly. The protein mediates innate antiviral activity. Mutations in this gene result in Immunodeficiency 44.
• Source: E. coli
• Species: Human
• Tag: C-His
• Protein length: 679-851aa
• Molecular Mass: 21 kDa
• AA Sequence: MQEKVNLQERRKYLKHRLIVVSNRQVDELQQPLELKPEPELESLELELGLVPEPELSLDLEPLLKAGLDLGPELESVLESTLEPVIEPTLCMVSQTVPEPDQGPVSQPVPEPDLPCDLRHLNTEPMEIFRNCVKIEEIMPNGDPLLAGQNTVDEVYVSRPSHFYTDGPLMPSDFHHHHHHHH
• Endotoxin: < 1 EU/μg by LAL.
• Purity: > 90 % by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 1 mg/mL by BCA
• Storage Buffer: Sterile PBS, pH7.4.

Gene Information

• Gene Name: STAT2 signal transducer and activator of transcription 2, 113kDa [Homo sapiens (human)]
• Official Symbol: STAT2
• Synonyms: STAT2; signal transducer and activator of transcription 2, 113kDa; signal transducer and activator of transcription 2, 113kD; signal transducer and activator of transcription 2; STAT113; interferon alpha induced transcriptional activator; P113; ISGF-3; MGC59816
• Gene ID: 6773
• mRNA Refseq: NM_005419
• Protein Refseq: NP_005410
• MIM: 600556
• UniProt ID: P52630