Recombinant Human signal transducer and activator of transcription 2, 113kDa Protein, His tagged
Cat.No. : | STAT2-01H |
Product Overview : | Recombinant Human STAT2 Protein (679-851aa) with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 679-851aa |
Description : | The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. In response to interferon (IFN), this protein forms a complex with STAT1 and IFN regulatory factor family protein p48 (ISGF3G), in which this protein acts as a transactivator, but lacks the ability to bind DNA directly. The protein mediates innate antiviral activity. Mutations in this gene result in Immunodeficiency 44. |
Tag : | C-His |
Molecular Mass : | 21 kDa |
AA Sequence : | MQEKVNLQERRKYLKHRLIVVSNRQVDELQQPLELKPEPELESLELELGLVPEPELSLDLEPLLKAGLDLGPELESVLESTLEPVIEPTLCMVSQTVPEPDQGPVSQPVPEPDLPCDLRHLNTEPMEIFRNCVKIEEIMPNGDPLLAGQNTVDEVYVSRPSHFYTDGPLMPSDFHHHHHHHH |
Endotoxin : | < 1 EU/μg by LAL. |
Purity : | > 90 % by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 1 mg/mL by BCA |
Storage Buffer : | Sterile PBS, pH7.4. |
Gene Name | STAT2 signal transducer and activator of transcription 2, 113kDa [Homo sapiens (human)] |
Official Symbol | STAT2 |
Synonyms | STAT2; signal transducer and activator of transcription 2, 113kDa; signal transducer and activator of transcription 2, 113kD; signal transducer and activator of transcription 2; STAT113; interferon alpha induced transcriptional activator; P113; ISGF-3; MGC59816 |
Gene ID | 6773 |
mRNA Refseq | NM_005419 |
Protein Refseq | NP_005410 |
MIM | 600556 |
UniProt ID | P52630 |
◆ Recombinant Proteins | ||
STAT2-151H | Recombinant Human STAT2 Protein, His-tagged | +Inquiry |
STAT2-01H | Recombinant Human signal transducer and activator of transcription 2, 113kDa Protein, His tagged | +Inquiry |
STAT2-8474H | Recombinant Human STAT2, His-tagged | +Inquiry |
STAT2-333H | Recombinant Human STAT2 protein, His/MBP-tagged | +Inquiry |
STAT2-2515H | Active Recombinant Human STAT2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
STAT2-1419HCL | Recombinant Human STAT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All STAT2 Products
Required fields are marked with *
My Review for All STAT2 Products
Required fields are marked with *
0
Inquiry Basket