Recombinant Human SIGLEC6, His-tagged

• Cat.No.: SIGLEC6-59H
• Product Overview: Recombinant Human Sialic Acid-Binding Ig-Like Lectin 6/SIGLEC6 produced by transfected human cells is a secreted protein with sequence (Gln27-Val347) of Human siglec-6/CD327 fused with a polyhistidine tag at the C-terminus.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 27-347 a.a.
• Form: Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.4
• AA Sequence: QERRFQLEGPESLTVQEGLCVLVPCRLPTTLPASYYGYGYWFLEGADVPVATNDPDEEVQEETRG RFHLLWDPRRKNCSLSIRDARRRDNAAYFFRLKSKWMKYGYTSSKLSVRVMALTHRPNISIPGTL ESGHPSNLTCSVPWVCEQGTPPIFSWMSAAPTSLGPRTTQSSVLTITPRPQDHSTNLTCQVTFPG AGVTMERTIQLNVSSFKILQNTSSLPVLEGQALRLLCDADGNPPAHLSWFQGFPALNATPISNTG VLELPQVGSAEEGDFTCRAQHPLGSLQISLSLFVHWKPEGRAGGVDHHHHHH
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
• Storage: Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at
• Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: SIGLEC6 sialic acid binding Ig-like lectin 6 [ Homo sapiens ]
• Official Symbol: SIGLEC6
• Synonyms: SIGLEC6; sialic acid binding Ig-like lectin 6; CD33L, CD33L1; sialic acid-binding Ig-like lectin 6; CD327; OB BP1; SIGLEC 6; CD33 antigen-like 1; obesity-binding protein 1; CD33L; OBBP1; CD33L1; CD33L2; CDW327
• Gene ID: 946
• mRNA Refseq: NM_001177547
• Protein Refseq: NP_001171018
• MIM: 604405
• UniProt ID: O43699
• Chromosome Location: 19q13.3
• Function: sugar binding