Recombinant Human SIGLEC6 Protein, His-tagged

• Cat.No.: SIGLEC6-191H
• Product Overview: Recombinant Human SIGLEC6 Protein with His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: Two families of mammalian lectin-like adhesion molecules, the selectins and the sialoadhesins, bind glycoconjugate ligands in a sialic acid-dependent manner. The sialic acid-binding immunoglobulin superfamily lectins, designated Siglecs or sialoadhesins, recognize sialylated ligands and play a key role in mediating sialic-acid dependent binding to cells. Siglec-6, also called obesitybinding protein 1, is an adhesion molecule that is highly expressed in placental trophoblasts, as well as in peripheral blood leukocytes. Siglec-6 can bind both N-acetylneuraminic acid (Neu5Ac) and N-glycolylneuraminic acid (Neu5Gc), the two common sialic acids found in mammalian cells. Together with the other members of the Siglec family, Siglec-6 promotes cell-cell interactions and plays a roll in the innate and adaptive immune systems through glycan recognition.
• Molecular Mass: ~35 kDa
• AA Sequence: QERRFQLEGPESLTVQEGLCVLVPCRLPTTLPASYYGYGYWFLEGADVPVATNDPDEEVQEETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYFFRLKSKWMKYGYTSSKLSVRVMALTHRPNISIPGTLESGHPSNLTCSVPWVCEQGTPPIFSWMSAAPTSLGPRTTQSSVLTITPRPQDHSTNLTCQVTFPGAGVTMERTIQLNVSYAPQKVAISIFQGNSAAFKILQNTSSLPVLEGQALRLLCDADGNPPAHLSWFQGFPALNATPISNTGVLELPQVGSAEEGDFTCRAQHPLGSLQISLSLFVHWKPEGRAGGV
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
• Notes: For research use only, not for use in diagnostic procedure.
• Storage: Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
• Concentration: ≥0.5 mg/mL
• Storage Buffer: PBS, 4M Urea, pH7.4

Gene Information

• Gene Name: SIGLEC6 sialic acid binding Ig-like lectin 6 [ Homo sapiens (human) ]
• Official Symbol: SIGLEC6
• Synonyms: SIGLEC6; sialic acid binding Ig-like lectin 6; CD33L, CD33L1; sialic acid-binding Ig-like lectin 6; CD327; OB BP1; SIGLEC 6; CD33 antigen-like 1; obesity-binding protein 1; CD33L; OBBP1; CD33L1; CD33L2; CDW327
• Gene ID: 946
• mRNA Refseq: NM_001177547
• Protein Refseq: NP_001171018
• MIM: 604405
• UniProt ID: O43699