Recombinant Human SGPL1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SGPL1-3141H |
Product Overview : | SGPL1 MS Standard C13 and N15-labeled recombinant protein (NP_003892) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Cleaves phosphorylated sphingoid bases (PSBs), such as sphingosine-1-phosphate, into fatty aldehydes and phosphoethanolamine. Elevates stress-induced ceramide production and apoptosis. Required for global lipid homeostasis in liver and cholesterol homeostasis in fibroblasts. Involved in the regulation of pro-inflammatory response and neutrophil trafficking. Modulates neuronal autophagy via phosphoethanolamine production which regulates accumulation of aggregate-prone proteins such as APP. Seems to play a role in establishing neuronal contact sites and axonal maintenance. |
Molecular Mass : | 63.3 kDa |
AA Sequence : | MPSTDLLMLKAFEPYLEILEVYSTKAKNYVNGHCTKYEPWQLIAWSVVWTLLIVWGYEFVFQPESLWSRFKKKCFKLTRKMPIIGRKIQDKLNKTKDDISKNMSFLKVDKEYVKALPSQGLSSSAVLEKLKEYSSMDAFWQEGRASGTVYSGEEKLTELLVKAYGDFAWSNPLHPDIFPGLRKIEAEIVRIACSLFNGGPDSCGCVTSGGTESILMACKAYRDLAFEKGIKTPEIVAPQSAHAAFNKAASYFGMKIVRVPLTKMMEVDVRAMRRAISRNTAMLVCSTPQFPHGVIDPVPEVAKLAVKYKIPLHVDACLGGFLIVFMEKAGYPLEHPFDFRVKGVTSISADTHKYGYAPKGSSLVLYSDKKYRNYQFFVDTDWQGGIYASPTIAGSRPGGISAACWAALMHFGENGYVEATKQIIKTARFLKSELENIKGIFVFGNPQLSVIALGSRDFDIYRLSNLMTAKGWNLNQLQFPPSIHFCITLLHARKRVAIQFLKDIRESVTQIMKNPKAKTTGMGAIYGMAQTTVDRNMVAELSSVFLDSLYSTDTVTQGSQMNGSPKPHTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SGPL1 sphingosine-1-phosphate lyase 1 [ Homo sapiens (human) ] |
Official Symbol | SGPL1 |
Synonyms | SGPL1; sphingosine-1-phosphate lyase 1; SPL; hSPL; SPL 1; SP-lyase 1; sphingosine-1-phosphate aldolase; S1PL; FLJ13811; KIAA1252; |
Gene ID | 8879 |
mRNA Refseq | NM_003901 |
Protein Refseq | NP_003892 |
MIM | 603729 |
UniProt ID | O95470 |
◆ Recombinant Proteins | ||
SGPL1-1997H | Recombinant Human SGPL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SGPL1-15042M | Recombinant Mouse SGPL1 Protein | +Inquiry |
SGPL1-3141H | Recombinant Human SGPL1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SGPL1-2874H | Recombinant Human SGPL1 protein, His-tagged | +Inquiry |
SGPL1-5027R | Recombinant Rat SGPL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SGPL1-1595HCL | Recombinant Human SGPL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SGPL1 Products
Required fields are marked with *
My Review for All SGPL1 Products
Required fields are marked with *
0
Inquiry Basket