Recombinant Human SFTPA1 Protein (21-248 aa), His-tagged

Cat.No. : SFTPA1-2539H
Product Overview : Recombinant Human SFTPA1 Protein (21-248 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : In presence of calcium ions, it binds to surfactant phospholipids and contributes to lower the surface tension at the air-liquid interface in the alveoli of the mammalian lung and is essential for normal respiration. Enhances the expression of MYO18A/SP-R210 on alveolar macrophages. (Microbial infection) Recognition of M.tuberculosis by dendritic cells may occur partially via this molecule. Can recognize, bind, and opsonize pathogens to enhance their elimination by alveolar macrophages.
Source : Yeast
Species : Human
Tag : His
Form : Tris-based buffer,50% glycerol
Molecular Mass : 26.2 kDa
Protein length : 21-248 aa
AA Sequence : EVKDVCVGSPGIPGTPGSHGLPGRDGRDGLKGDPGPPGPMGPPGEMPCPPGNDGLPGAPGIPGECGEKGEPGERGPPGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name SFTPA1 surfactant protein A1 [ Homo sapiens ]
Official Symbol SFTPA1
Synonyms SFTPA1; surfactant protein A1; COLEC4; SP A; SP A1; collectin-4; SPA; PSAP; PSPA; SP-A; SPA1; PSP-A; SFTP1; SP-A1; SFTPA1B; FLJ50593; FLJ51913; FLJ61144; FLJ77898; FLJ79095; FLJ99559; MGC133365; MGC198590;
Gene ID 653509
mRNA Refseq NM_001093770
Protein Refseq NP_001087239
MIM 178630
UniProt ID Q8IWL2

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SFTPA1 Products

Required fields are marked with *

My Review for All SFTPA1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon