Recombinant Human SFTPA1 protein, GST-tagged
Cat.No. : | SFTPA1-14H |
Product Overview : | Recombinant Human SFTPA1(83 a.a. - 199 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 83-199 a.a. |
Description : | This gene encodes a lung surfactant protein that is a member of a subfamily of C-type lectins called collectins. The encoded protein binds specific carbohydrate moieties found on lipids and on the surface of microorganisms. This protein plays an essential role in surfactant homeostasis and in the defense against respiratory pathogens. Mutations in this gene are associated with idiopathic pulmonary fibrosis. Alternate splicing results in multiple transcript variants. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 38.61 kDa |
AA Sequence : | MTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPV NYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | SFTPA1 surfactant protein A1 [ Homo sapiens ] |
Official Symbol | SFTPA1 |
Synonyms | SFTPA1; surfactant protein A1; SFTP1, surfactant, pulmonary associated protein A1; pulmonary surfactant-associated protein A1; COLEC4; SP A; SP A1; surfactant; pulmonary associated protein A1A; collectin-4; surfactant protein A1B; alveolar proteinosis protein; surfactant protein A1 variant AD 6A; surfactant protein A1 variant AD 6A2; surfactant protein A1 variant AD 6A3; surfactant protein A1 variant AD 6A4; surfactant protein A1 variant ACD 6A2; surfactant protein A1 variant ACD 6A3; surfactant protein A1 variant ACD 6A4; surfactant protein A1 variant ABD 6A2; surfactant protein A1 variant ABD 6A3; surfactant protein A1 variant ABD 6A4; surfactant, pulmonary-associated protein A1A; surfactant, pulmonary-associated protein A1B; 35 kDa pulmonary surfactant-associated protein; SPA; PSAP; PSPA; SP-A; SPA1; PSP-A; SFTP1; SP-A1; SFTPA1B; FLJ50593; FLJ51913; FLJ61144; FLJ77898; FLJ79095; FLJ99559; MGC133365; MGC198590; |
Gene ID | 653509 |
mRNA Refseq | NM_001164646 |
Protein Refseq | NP_001158118 |
MIM | 178630 |
UniProt ID | Q8IWL2 |
Chromosome Location | 10q22.3 |
Pathway | FOXA1 transcription factor network, organism-specific biosystem; Pertussis, organism-specific biosystem; Pertussis, conserved biosystem; Phagosome, organism-specific biosystem; Phagosome, conserved biosystem; |
Function | binding; lipid transporter activity; sugar binding; |
◆ Recombinant Proteins | ||
SFTPA1-2539H | Recombinant Human SFTPA1 Protein (21-248 aa), His-tagged | +Inquiry |
SFTPA1-3993R | Recombinant Rhesus Macaque SFTPA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL6711HF | Recombinant Full Length Human Pulmonary Surfactant-Associated Protein A1(Sftpa1) Protein, His&Myc-Tagged | +Inquiry |
SFTPA1-11H | Recombinant Human SFTPA1 protein, MYC/DDK-tagged | +Inquiry |
SFTPA1-12H | Recombinant Human SFTPA1 protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SFTPA1 Products
Required fields are marked with *
My Review for All SFTPA1 Products
Required fields are marked with *
0
Inquiry Basket