Recombinant Human SERPINB3 protein(251-360 aa), C-His-tagged
Cat.No. : | SERPINB3-2715H |
Product Overview : | Recombinant Human SERPINB3 protein(P29508)(251-360 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 251-360 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | IDGLQKLEEKLTAEKLMEWTSLQNMRETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVVGFGSSPTSTN |
Gene Name | SERPINB3 serpin peptidase inhibitor, clade B (ovalbumin), member 3 [ Homo sapiens ] |
Official Symbol | SERPINB3 |
Synonyms | SERPINB3; serpin peptidase inhibitor, clade B (ovalbumin), member 3; SCC, SCCA1, serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 3; serpin B3; HsT1196; T4 A; protein T4-A; squamous cell carcinoma antigen 1; serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 3; SCC; T4-A; SCCA1; SCCA-1; SCCA-PD; |
Gene ID | 6317 |
mRNA Refseq | NM_006919 |
Protein Refseq | NP_008850 |
MIM | 600517 |
UniProt ID | P29508 |
◆ Recombinant Proteins | ||
SERPINB3-5477H | Recombinant Human SERPINB3 protein | +Inquiry |
SERPINB3-464HF | Recombinant Full Length Human SERPINB3 Protein | +Inquiry |
SERPINB3-2593H | Recombinant Human SERPINB3, GST-tagged | +Inquiry |
SERPINB3-38H | Recombinant Human SERPINB3 Protein, C-6His tagged, Biotinylated | +Inquiry |
SERPINB3-6238H | Recombinant Human SERPINB3 Protein (Met1-Ile210), His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SERPINB3-460HCL | Recombinant Human SERPINB3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SERPINB3 Products
Required fields are marked with *
My Review for All SERPINB3 Products
Required fields are marked with *
0
Inquiry Basket