Recombinant Human SERPINB3 protein(251-360 aa), C-His-tagged

• Cat.No.: SERPINB3-2715H
• Product Overview: Recombinant Human SERPINB3 protein(P29508)(251-360 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 251-360 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: IDGLQKLEEKLTAEKLMEWTSLQNMRETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVVGFGSSPTSTN

Gene Information

• Gene Name: SERPINB3 serpin peptidase inhibitor, clade B (ovalbumin), member 3 [ Homo sapiens ]
• Official Symbol: SERPINB3
• Synonyms: SERPINB3; serpin peptidase inhibitor, clade B (ovalbumin), member 3; SCC, SCCA1, serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 3; serpin B3; HsT1196; T4 A; protein T4-A; squamous cell carcinoma antigen 1; serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 3; SCC; T4-A; SCCA1; SCCA-1; SCCA-PD
• Gene ID: 6317
• mRNA Refseq: NM_006919
• Protein Refseq: NP_008850
• MIM: 600517
• UniProt ID: P29508