Recombinant Human SERPINB1 protein(211-340 aa), C-His-tagged

• Cat.No.: SERPINB1-2718H
• Product Overview: Recombinant Human SERPINB1 protein(P30740)(211-340 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 211-340 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: DLKCRVLELPYQGEELSMVILLPDDIEDESTGLKKIEEQLTLEKLHEWTKPENLDFIEVNVSLPRFKLEESYTLNSDLARLGVQDLFNSSKADLSGMSGARDIFISKIVHKSFVEVNEEGTEAAAATAGI

Gene Information

• Gene Name: SERPINB1 serpin peptidase inhibitor, clade B (ovalbumin), member 1 [ Homo sapiens ]
• Official Symbol: SERPINB1
• Synonyms: SERPINB1; serpin peptidase inhibitor, clade B (ovalbumin), member 1; ELANH2, serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 1; leukocyte elastase inhibitor; anti elastase; EI; PI2; PI-2; serpin B1; anti-elastase; peptidase inhibitor 2; monocyte/neutrophil elastase inhibitor; protease inhibitor 2 (anti-elastase), monocyte/neutrophil derived; serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 1; LEI; MNEI; M/NEI; ELANH2
• Gene ID: 1992
• mRNA Refseq: NM_030666
• Protein Refseq: NP_109591
• MIM: 130135
• UniProt ID: P30740