Active Recombinant Full Length Human SERPINB1 Protein, C-Flag-tagged
Cat.No. : | SERPINB1-219HFL |
Product Overview : | Recombinant Full Length Human SERPINB1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a member of the serpin family of proteinase inhibitors. Members of this family maintain homeostasis by neutralizing overexpressed proteinase activity through their function as suicide substrates. This protein inhibits the neutrophil-derived proteinases neutrophil elastase, cathepsin G, and proteinase-3 and thus protects tissues from damage at inflammatory sites. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Peptidase assay (inhibitor) ELISA standard |
Molecular Mass : | 42.6 kDa |
AA Sequence : | MEQLSSANTRFALDLFLALSENNPAGNIFISPFSISSAMAMVFLGTRGNTAAQLSKTFHFNTVEEVHSRF QSLNADINKRGASYILKLANRLYGEKTYNFLPEFLVSTQKTYGADLASVDFQHASEDARKTINQWVKGQT EGKIPELLASGMVDNMTKLVLVNAIYFKGNWKDKFMKEATTNAPFRLNKKDRKTVKMMYQKKKFAYGYIE DLKCRVLELPYQGEELSMVILLPDDIEDESTGLKKIEEQLTLEKLHEWTKPENLDFIEVNVSLPRFKLEE SYTLNSDLARLGVQDLFNSSKADLSGMSGARDIFISKIVHKSFVEVNEEGTEAAAATAGIATFCMLMPEE NFTADHPFLFFIRHNSSGSILFLGRFSSPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | SERPINB1 serpin family B member 1 [ Homo sapiens (human) ] |
Official Symbol | SERPINB1 |
Synonyms | EI; LEI; PI2; MNEI; PI-2; HEL57; M/NEI; ELANH2; HEL-S-27 |
Gene ID | 1992 |
mRNA Refseq | NM_030666.4 |
Protein Refseq | NP_109591.1 |
MIM | 130135 |
UniProt ID | P30740 |
◆ Recombinant Proteins | ||
SERPINB1-763Z | Recombinant Zebrafish SERPINB1 | +Inquiry |
SERPINB1-0055H | Recombinant Human SERPINB1 Protein (Full Length), Tag Free | +Inquiry |
SERPINB1-857H | Recombinant Human SERPINB1 Protein, MYC/DDK-tagged | +Inquiry |
SERPINB1-463HF | Recombinant Full Length Human SERPINB1 Protein | +Inquiry |
SERPINB1-90H | Recombinant Human SERPINB1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SERPINB1-578HCL | Recombinant Human SERPINB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SERPINB1 Products
Required fields are marked with *
My Review for All SERPINB1 Products
Required fields are marked with *
0
Inquiry Basket