Recombinant Human SERPINA4 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SERPINA4-5800H
• Product Overview: SERPINA4 MS Standard C13 and N15-labeled recombinant protein (NP_006206) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: SERPINA4 (Serpin Family A Member 4) is a Protein Coding gene. Diseases associated with SERPINA4 include Robinow Syndrome, Autosomal Dominant 2 and Ritscher-Schinzel Syndrome 2. Among its related pathways are Response to elevated platelet cytosolic Ca2+. Gene Ontology (GO) annotations related to this gene include serine-type endopeptidase inhibitor activity. An important paralog of this gene is SERPINA3.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 48.5 kDa
• AA Sequence: MHLIDYLLLLLVGLLALSHGQLHVEHDGESCSNSSHQQILETGEGSPSLKIAPANADFAFRFYYLIASETPGKNIFFSPLSISAAYAMLSLGACSHSRSQILEGLGFNLTELSESDVHRGFQHLLHTLNLPGHGLETRVGSALFLSHNLKFLAKFLNDTMAVYEAKLFHTNFYDTVGTIQLINDHVKKETRGKIVDLVSELKKDVLMVLVNYIYFKALWEKPFISSRTTPKDFYVDENTTVRVPMMLQDQEHHWYLHDRYLPCSVLRMDYKGDATVFFILPNQGKMREIEEVLTPEMLMRWNNLLRKRNFYKKLELHLPKFSISGSYVLDQILPRLGFTDLFSKWADLSGITKQQKLEASKSFHKATLDVDEAGTEAAAATSFAIKFFSAQTNRHILRFNRPFLVVIFSTSTQSVLFLGKVVDPTKPSGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SERPINA4 serpin family A member 4 [ Homo sapiens (human) ]
• Official Symbol: SERPINA4
• Synonyms: KAL; KST; PI4; KLST; PI-4; kallistatin
• Gene ID: 5267
• mRNA Refseq: NM_006215
• Protein Refseq: NP_006206
• MIM: 147935
• UniProt ID: P29622