Recombinant Human SERPINA4, His-tagged

Cat.No. : SERPINA4-16H
Product Overview : Recombinant Human Serpin A4 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Gln21-Pro427) of Human SERPINA4 fused with a polyhistidine tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Serpin Peptidase Inhibitor, Clade A (α-1 Antiproteinase, Antitrypsin), Member 4 (Serpin A4) is a member of the Serpin family. Serpin A4 exists as a monomer and some homodimers. Serpin A4 is expressed by the liver and secreted in plasma. Serpin A4 is a regulator of vascular homeostasis capable of controlling a wide spectrum of biological actions in the cardiovascular and renal systems. It can inhibit intracellular reactive oxygen species formation in cultured cardiac and renal cells. In addition, Serpin A4 has anti-inflammatory effect. Heparin blocks kallistatin's complex formation with tissue kallikrein and abolishes its inhibitory effect on tissue kallikrein's activity.
Source : HEK293
Species : Human
Tag : His
Form : Lyophilized from a 0.2 μM filtered solution of 50mM Tris-HCl, 150mM NaCl, 10mM NaCl, pH 8.0.
AA Sequence : QLHVEHDGESCSNSSHQQILETGEGSPSLKIAPANADFAFRFYYLIASETPGKNIFFSPLSISAA YAMLSLGACSHSRSQILEGLGFNLTELSESDVHRGFQHLLHTLNLPGHGLETRVGSALFLSHNLK FLAKFLNDTMAVYEAKLFHTNFYDTVGTIQLINDHVKKETRGKIVDLVSELKKDVLMVLVNYIYF KALWEKPFISSRTTPKDFYVDENTTVRVPMMLQDQEHHWYLHDRYLPCSVLRMDYKGDATVFFIL PNQGKMREIEEVLTPEMLMRWNNLLRKRNFYKKLELHLPKFSISGSYVLDQILPRLGFTDLFSKW ADLSGITKQQKLEASKSFHKATLDVDEAGTEAAAATSFAIKFFSAQTNRHILRFNRPFLVVIFST STQSVLFLGKVVDPTKPHHHHHH
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage : Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Shipping : The product is shipped at ambient temperature.
Protein length : 21-427 a.a.
Gene Name SERPINA4 serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 4 [ Homo sapiens ]
Official Symbol SERPINA4
Synonyms SERPINA4; serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 4; PI4, serine (or cysteine) proteinase inhibitor, clade A (alpha 1 antiproteinase, antitrypsin), member 4; kallistatin; KAL; KLST; KST
Gene ID 5267
mRNA Refseq NM_006215
Protein Refseq NP_006206
MIM 147935
UniProt ID P29622
Chromosome Location 14q32.13
Function serine-type endopeptidase inhibitor activity

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SERPINA4 Products

Required fields are marked with *

My Review for All SERPINA4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon