Recombinant Human SERPINA4, His-tagged
Cat.No. : | SERPINA4-16H |
Product Overview : | Recombinant Human Serpin A4 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Gln21-Pro427) of Human SERPINA4 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 21-427 a.a. |
Description : | Serpin Peptidase Inhibitor, Clade A (α-1 Antiproteinase, Antitrypsin), Member 4 (Serpin A4) is a member of the Serpin family. Serpin A4 exists as a monomer and some homodimers. Serpin A4 is expressed by the liver and secreted in plasma. Serpin A4 is a regulator of vascular homeostasis capable of controlling a wide spectrum of biological actions in the cardiovascular and renal systems. It can inhibit intracellular reactive oxygen species formation in cultured cardiac and renal cells. In addition, Serpin A4 has anti-inflammatory effect. Heparin blocks kallistatin's complex formation with tissue kallikrein and abolishes its inhibitory effect on tissue kallikrein's activity. |
Form : | Lyophilized from a 0.2 μM filtered solution of 50mM Tris-HCl, 150mM NaCl, 10mM NaCl, pH 8.0. |
AA Sequence : | QLHVEHDGESCSNSSHQQILETGEGSPSLKIAPANADFAFRFYYLIASETPGKNIFFSPLSISAA YAMLSLGACSHSRSQILEGLGFNLTELSESDVHRGFQHLLHTLNLPGHGLETRVGSALFLSHNLK FLAKFLNDTMAVYEAKLFHTNFYDTVGTIQLINDHVKKETRGKIVDLVSELKKDVLMVLVNYIYF KALWEKPFISSRTTPKDFYVDENTTVRVPMMLQDQEHHWYLHDRYLPCSVLRMDYKGDATVFFIL PNQGKMREIEEVLTPEMLMRWNNLLRKRNFYKKLELHLPKFSISGSYVLDQILPRLGFTDLFSKW ADLSGITKQQKLEASKSFHKATLDVDEAGTEAAAATSFAIKFFSAQTNRHILRFNRPFLVVIFST STQSVLFLGKVVDPTKPHHHHHH |
Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : | Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Shipping : | The product is shipped at ambient temperature. |
Gene Name | SERPINA4 serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 4 [ Homo sapiens ] |
Official Symbol | SERPINA4 |
Synonyms | SERPINA4; serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 4; PI4, serine (or cysteine) proteinase inhibitor, clade A (alpha 1 antiproteinase, antitrypsin), member 4; kallistatin; KAL; KLST; KST |
Gene ID | 5267 |
mRNA Refseq | NM_006215 |
Protein Refseq | NP_006206 |
MIM | 147935 |
UniProt ID | P29622 |
Chromosome Location | 14q32.13 |
Function | serine-type endopeptidase inhibitor activity |
◆ Recombinant Proteins | ||
SERPINA4-185H | Active Recombinant Human SERPINA4, His-tagged | +Inquiry |
SERPINA4-1974H | Recombinant Human SERPINA4 Protein, His (Fc)-Avi-tagged | +Inquiry |
SERPINA4-5911H | Recombinant Human SERPINA4 Protein (Gln21-Pro427), C-His tagged | +Inquiry |
SERPINA4-860H | Recombinant Human SERPINA4 Protein, MYC/DDK-tagged | +Inquiry |
SERPINA4-2178HFL | Recombinant Full Length Human SERPINA4 Protein, C-Flag-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SERPINA4 Products
Required fields are marked with *
My Review for All SERPINA4 Products
Required fields are marked with *
0
Inquiry Basket