Recombinant Human SERPINA1 Protein (AA 25-418), N-His-Tagged
| Cat.No. : | SERPINA1-71H |
| Product Overview : | Recombinant Human SERPINA1 Protein (AA 25-418) with N-His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Description : | The protein encoded by this gene is a serine protease inhibitor belonging to the serpin superfamily whose targets include elastase, plasmin, thrombin, trypsin, chymotrypsin, and plasminogen activator. This protein is produced in the liver, the bone marrow, by lymphocytic and monocytic cells in lymphoid tissue, and by the Paneth cells of the gut. Defects in this gene are associated with chronic obstructive pulmonary disease, emphysema, and chronic liver disease. Several transcript variants encoding the same protein have been found for this gene. |
| Source : | HEK293 |
| Species : | Human |
| Tag : | His |
| Form : | Liquid |
| Protein length : | AA 25-418 |
| AA Sequence : | EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK |
| Purity : | > 95% as determined by SDS-PAGE |
| Storage : | Stored and shipped at -80 centigrade |
| Storage Buffer : | 10 mM Tris, 200 mM NaCl, 1 mM EDTA, 1 mM ß-Mercaptoethanol; pH 8.0 |
| Gene Name | SERPINA1 serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1 [ Homo sapiens ] |
| Official Symbol | SERPINA1 |
| Synonyms | SERPINA1; serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1; PI, serine (or cysteine) proteinase inhibitor, clade A (alpha 1 antiproteinase, antitrypsin), member 1; alpha-1-antitrypsin; A1A; A1AT; AAT; alpha 1 antitrypsin; alpha1AT; PI1; protease inhibitor 1 (anti elastase); serpin A1; alpha-1-antiproteinase; alpha-1-antitrypsin null; alpha-1 protease inhibitor; protease inhibitor 1 (anti-elastase), alpha-1-antitrypsin; serine (or cysteine) proteinase inhibitor, clade A, member 1; PI; PRO2275; MGC9222; MGC23330 |
| Gene ID | 5265 |
| mRNA Refseq | NM_000295 |
| Protein Refseq | NP_000286 |
| MIM | 107400 |
| UniProt ID | P01009 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SERPINA1 Products
Required fields are marked with *
My Review for All SERPINA1 Products
Required fields are marked with *
0
Inquiry Basket
