Recombinant Human SEPP1 protein, His-tagged

Cat.No. : SEPP1-3478H
Product Overview : Recombinant Human SEPP1 protein(P49908)(20-381aa(U59S,U300S,U318S,U330S,U345S,U352S,U367S,U369S,U376S,U378S)), fused to N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 20-381aa(U59S,U300S,U318S,U330S,U345S,U352S,U367S,U369S,U376S,U378S)
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 44.6 kDa
AA Sequence : ESQDQSSLCKQPPAWSIRDQDPMLNSNGSVTVVALLQASSYLCILQASKLEDLRVKLKKEGYSNISYIVVNHQGISSRLKYTHLKNKVSEHIPVYQQEENQTDVWTLLNGSKDDFLIYDRCGRLVYHLGLPFSFLTFPYVEEAIKIAYCEKKCGNCSLTTLKDEDFCKRVSLATVDKTVETPSPHYHHEHHHNHGHQHLGSSELSENQQPGAPNAPTHPAPPGLHHHHKHKGQHRQGHPENRDMPASEDLQDLQKKLCRKRCINQLLCKLPTDSELAPRSSCCHCRHLIFEKTGSAITSQCKENLPSLCSSQGLRAEENITESCQSRLPPAASQISQQLIPTEASASSRSKNQAKKSESPSN
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name SEPP1 selenoprotein P, plasma, 1 [ Homo sapiens ]
Official Symbol SEPP1
Synonyms SEPP1; selenoprotein P, plasma, 1; selenoprotein P; SeP; SELP;
Gene ID 6414
mRNA Refseq NM_001085486
Protein Refseq NP_001078955
MIM 601484
UniProt ID P49908

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SEPP1 Products

Required fields are marked with *

My Review for All SEPP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon