Recombinant Human SDR42E1 Protein, GST-tagged
Cat.No. : | SDR42E1-5128H |
Product Overview : | Human HSPC105 full-length ORF ( NP_660151.1, 1 a.a. - 383 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | SDR42E1 (Short Chain Dehydrogenase/Reductase Family 42E, Member 1) is a Protein Coding gene. GO annotations related to this gene include oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor and 3-beta-hydroxy-delta5-steroid dehydrogenase activity. An important paralog of this gene is SDR42E2. |
Molecular Mass : | 69.6 kDa |
AA Sequence : | MDPKRSQKESVLITGGSGYFGFRLGCALNQNGVHVILFDISSPAQTIPEGIKFIQGDIRHLSDVEKAFQDADVTCVFHIASYGMSGREQLNRNLIKEVNVRGTDNILQVCQRRRVPRLVYTSTFNVIFGGQVIRNGDESLPYLPLHLHPDHYSRTKSIAEQKVLEANATPLDRGDGVLRTCALRPAGIYGPGEQRHLPRIVSYIEKGLFKFVYGDPRSLVEFVHVDNLVQAHILASEALRADKGHIASGQPYFISDGRPVNNFEFFRPLVEGLGYTFPSTRLPLTLVYCFAFLTEMVHFILGRLYNFQPFLTRTEVYKTGVTHYFSLEKAKKELGYKAQPFDLQEAVEWFKAHGHGRSSGSRDSECFVWDGLLVFLLIIAVLM |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | SDR42E1 short chain dehydrogenase/reductase family 42E, member 1 [ Homo sapiens ] |
Official Symbol | SDR42E1 |
Synonyms | HSPC105 |
Gene ID | 93517 |
mRNA Refseq | NM_145168 |
Protein Refseq | NP_660151 |
UniProt ID | Q8WUS8 |
◆ Recombinant Proteins | ||
SDR42E1-3934R | Recombinant Rhesus Macaque SDR42E1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SDR42E1-904C | Recombinant Cynomolgus SDR42E1 Protein, His-tagged | +Inquiry |
SDR42E1-14813M | Recombinant Mouse SDR42E1 Protein | +Inquiry |
SDR42E1-5128H | Recombinant Human SDR42E1 Protein, GST-tagged | +Inquiry |
SDR42E1-4117R | Recombinant Rhesus monkey SDR42E1 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SDR42E1 Products
Required fields are marked with *
My Review for All SDR42E1 Products
Required fields are marked with *
0
Inquiry Basket