Recombinant Human SDCBP protein, His-KSI-tagged

• Cat.No.: SDCBP-3977H
• Product Overview: Recombinant Human SDCBP protein(O00560)(2-298aa), fused with N-terminal His and KSI tag, was expressed in E.coli.

Specification

• Source: E.coli
• Species: Human
• Tag: N-His-KSI
• Protein length: 2-298aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 47.6 kDa
• AASequence: SLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAFIFEHIIKRMAPSIMKSLMDHTIPEV
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: SDCBP syndecan binding protein (syntenin) [ Homo sapiens ]
• Official Symbol: SDCBP
• Synonyms: SDCBP; syndecan binding protein (syntenin); syntenin-1; SYCL; scaffold protein Pbp1; syndecan-binding protein 1; melanoma differentiation associated protein-9; melanoma differentiation-associated protein 9; pro-TGF-alpha cytoplasmic domain-interacting protein 18; ST1; MDA-9; TACIP18
• Gene ID: 6386
• mRNA Refseq: NM_001007067
• Protein Refseq: NP_001007068
• MIM: 602217
• UniProt ID: O00560