Recombinant Human SDC2 Protein, C-His-tagged

• Cat.No.: SDC2-127H
• Product Overview: Recombinant Human SDC2 Protein with C-His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 19-144 a.a.
• Description: Syndecans are type I integral membrane proteoglycans that contain both chondroitin sulfate and heparan sulfate groups. Syndecans are involved in cell-extracellular matrix adhesion and growth factor binding. Syndecan-1 (SYND1, also called CD138) is anextracellular matrix receptor which binds to collagens, Fibronectin and Thrombospondin. Syndecan-1 and Syndecan-3 (also designated N-Syndecan) interact with MK (midkine), a growth/differentiation factor invloved in embryogenesis of the central nervous system. Syndecan-2 (also designated fibroglycan or HSPG) is highly expressed at areas of high morphogenetic activity, such as epithelial-mesenchymal interfaces and the prechondrogenic and preosteogenic mesenchymal condensations. Syndecan-4 (also designated amphiglycan or ryudocan) functions cooperativley with integrins in the processes of cell spreading, focal adhesion assembly and Actin stress fiber assembly
• Molecular Mass: ~14 kDa
• AA Sequence: ESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTTSRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLFKRTE
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
• Notes: For research use only, not for use in diagnostic procedure.
• Storage: Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
• Concentration: ≥0.5 mg/mL
• Storage Buffer: PBS, 4M Urea, pH7.4

Gene Information

• Gene Name: SDC2 syndecan 2 [ Homo sapiens (human) ]
• Official Symbol: SDC2
• Synonyms: SDC2; syndecan 2; heparan sulfate proteoglycan 1, cell surface associated , HSPG, HSPG1; syndecan-2; CD362; fibroglycan; SYND2; syndecan proteoglycan 2; heparan sulfate proteoglycan core protein; cell surface-associated heparan sulfate proteoglycan 1; heparan sulfate proteoglycan 1, cell surface-associated; HSPG; HSPG1
• Gene ID: 6383
• mRNA Refseq: NM_002998
• Protein Refseq: NP_002989
• MIM: 142460
• UniProt ID: P34741