Recombinant Full Length Mouse Syndecan-2(Sdc2) Protein, His-Tagged

Cat.No. : RFL7409MF
Product Overview : Recombinant Full Length Mouse Syndecan-2(Sdc2) Protein (P43407) (19-202aa), fused to N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : E.coli expression system
Species : Mus musculus (Mouse)
Tag : His
Form : Lyophilized powder
Protein length : Full Length of Mature Protein (19-202)
AA Sequence : ETRTELTSDKDMYLDNSSIEEASGVYPIDDDDYSSASGSGADEDIESPVLTTSQLIPRIPLTSAASPKVETMTLKTQSITPAQTESPEETDKEEVDISEAEEKLGPAIKSTDVYTEKHSDNLFKRTEVLAAVIAGGVIGFLFAIFLILLLVYRMRKKDEGSYDLGERKPSSAAYQKAPTKEFYA
Purity : Greater than 90% as determined by SDS-PAGE.
Applications : SDS-PAGE
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Storage Buffer : Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Gene Name Sdc2
Synonyms Sdc2; Hspg1; Synd2; Syndecan-2; SYND2; Fibroglycan; Heparan sulfate proteoglycan core protein; HSPG; CD antigen CD362
UniProt ID P43407

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All Sdc2 Products

Required fields are marked with *

My Review for All Sdc2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon