Recombinant Human SCRG1 Protein (21-98 aa), His-tagged

Cat.No. : SCRG1-1647H
Product Overview : Recombinant Human SCRG1 Protein (21-98 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Neuroscience. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : Yeast
Species : Human
Tag : His
Form : Tris-based buffer,50% glycerol
Molecular Mass : 10.9 kDa
Protein length : 21-98 aa
AA Sequence : MPANRLSCYRKILKDHNCHNLPEGVADLTQIDVNVQDHFWDGKGCEMICYCNFSELLCCPKDVFFGPKISFVIPCNNQ
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name SCRG1 stimulator of chondrogenesis 1 [ Homo sapiens ]
Official Symbol SCRG1
Synonyms SCRG-1;
Gene ID 11341
mRNA Refseq NM_007281.2
Protein Refseq NP_009212.1
MIM 603163
UniProt ID O75711

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SCRG1 Products

Required fields are marked with *

My Review for All SCRG1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon