Recombinant Human SCRG1 protein, His-tagged

• Cat.No.: SCRG1-4353H
• Product Overview: Recombinant Human SCRG1 protein(O75711)(21-98aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 21-98aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 12.9 kDa
• AA Sequence: MPANRLSCYRKILKDHNCHNLPEGVADLTQIDVNVQDHFWDGKGCEMICYCNFSELLCCPKDVFFGPKISFVIPCNNQ
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: SCRG1 stimulator of chondrogenesis 1 [ Homo sapiens ]
• Official Symbol: SCRG1
• Synonyms: SCRG-1
• Gene ID: 11341
• mRNA Refseq: NM_007281.2
• Protein Refseq: NP_009212.1
• MIM: 603163
• UniProt ID: O75711