Recombinant Human SCN3B protein, GST-tagged

• Cat.No.: SCN3B-301194H
• Product Overview: Recombinant Human SCN3B (23-93 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• ProteinLength: Phe23-Gln93
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: FPVCVEVPSETEAVQGNPMKLRCISCMKREEVEATTVVEWFYRPEGGKDFLIYEYRNGHQEVESPFQGRLQ
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: SCN3B sodium voltage-gated channel beta subunit 3 [ Homo sapiens (human) ]
• Official Symbol: SCN3B
• Synonyms: SCNB3; ATFB16; BRGDA7; HSA243396
• Gene ID: 55800
• mRNA Refseq: NM_001040151
• Protein Refseq: NP_001035241
• MIM: 608214
• UniProt ID: Q9NY72