Recombinant Human SCGB1D2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SCGB1D2-5362H
• Product Overview: SCGB1D2 MS Standard C13 and N15-labeled recombinant protein (NP_006542) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: The protein encoded by this gene is a member of the lipophilin subfamily, part of the uteroglobin superfamily, and is an ortholog of prostatein, the major secretory glycoprotein of the rat ventral prostate gland. Lipophilin gene products are widely expressed in normal tissues, especially in endocrine-responsive organs. Assuming that human lipophilins are the functional counterparts of prostatein, they may be transcriptionally regulated by steroid hormones, with the ability to bind androgens, other steroids and possibly bind and concentrate estramustine, a chemotherapeutic agent widely used for prostate cancer. Although the gene has been reported to be on chromosome 10, this sequence appears to be from a cluster of genes on chromosome 11 that includes mammaglobin 2.
• Molecular Mass: 9.9 kDa
• AA Sequence: MKLSVCLLLVTLALCCYQANAEFCPALVSELLDFFFISEPLFKLSLAKFDAPPEAVAAKLGVKRCTDQMSLQKRSLIAEVLVKILKKCSVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SCGB1D2 secretoglobin family 1D member 2 [ Homo sapiens (human) ]
• Official Symbol: SCGB1D2
• Synonyms: SCGB1D2; secretoglobin, family 1D, member 2; secretoglobin family 1D member 2; LIPB; lipophilin B (uteroglobin family member); prostatein like; LPHB; prostatein like lipophilin B; lipophilin-B; prostatein-like lipophilin B
• Gene ID: 10647
• mRNA Refseq: NM_006551
• Protein Refseq: NP_006542
• MIM: 615061
• UniProt ID: O95969