Recombinant Human S1PR3

• Cat.No.: S1PR3-28463TH
• Product Overview: Recombinant fragment of Human EDG3 with a N terminal proprietary tag: predicted molecular weight 34.10 kDa.

Specification

• Description: This gene encodes a member of the EDG family of receptors, which are G protein-coupled receptors. This protein has been identified as a functional receptor for sphingosine 1-phosphate and likely contributes to the regulation of angiogenesis and vascular endothelial cell function.
• Protein length: 77 amino acids
• Molecular Weight: 34.100kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Expressed in all tissues, but most abundantly in heart, placenta, kidney, and liver.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: SKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPKVKEDLPHTAPSSCIMDKNAALQNGIFCN
• Sequence Similarities: Belongs to the G-protein coupled receptor 1 family.
• Tag: Non

Gene Information

• Gene Name: S1PR3 sphingosine-1-phosphate receptor 3 [ Homo sapiens ]
• Official Symbol: S1PR3
• Synonyms: S1PR3; sphingosine-1-phosphate receptor 3; EDG3, endothelial differentiation, sphingolipid G protein coupled receptor, 3; sphingosine 1-phosphate receptor 3; EDG 3; sphingosine 1 phosphate receptor 3
• Gene ID: 1903
• mRNA Refseq: NM_005226
• Protein Refseq: NP_005217
• MIM: 601965
• Uniprot ID: Q99500
• Chromosome Location: 9q22.1-q22.2
• Pathway: Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; Lysosphingolipid and LPA receptors, organism-specific biosystem
• Function: G-protein coupled receptor activity; lipid binding; lysosphingolipid and lysophosphatidic acid receptor activity; receptor activity; signal transducer activity