Recombinant Human S100A9 Protein, MYC/DDK-tagged, C13 and N15-labeled

• Cat.No.: S100A9-202H
• Product Overview: S100A9 MS Standard C13 and N15-labeled recombinant protein (NP_002956) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and altered expression of this protein is associated with the disease cystic fibrosis. This antimicrobial protein exhibits antifungal and antibacterial activity. [provided by RefSeq, Nov 2014]
• Molecular Mass: 13.2 kDa
• AA Sequence: MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: S100A9 S100 calcium binding protein A9 [ Homo sapiens (human) ]
• Official Symbol: S100A9
• Synonyms: S100A9; S100 calcium binding protein A9; CAGB, CFAG, S100 calcium binding protein A9 (calgranulin B), S100 calcium binding protein A9 (calgranulin B); protein S100-A9; 60B8AG; CGLB; LIAG; MAC387; MIF; MRP14; NIF; P14; MRP-14; calgranulin B; calgranulin-B; calprotectin L1H subunit; leukocyte L1 complex heavy chain; migration inhibitory factor-related protein 14; S100 calcium-binding protein A9 (calgranulin B); CAGB; CFAG; L1AG
• Gene ID: 6280
• mRNA Refseq: NM_002965
• Protein Refseq: NP_002956
• MIM: 123886
• UniProt ID: P06702