Recombinant Mouse S100a9 protein, His-SUMO-tagged

• Cat.No.: S100a9-3466M
• Product Overview: Recombinant Mouse S100a9 protein(P31725)(2-113aa), fused to N-terminal His-SUMO tag, was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 2-113aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 28.9 kDa
• AA Sequence: ANKAPSQMERSITTIIDTFHQYSRKEGHPDTLSKKEFRQMVEAQLATFMKKEKRNEALINDIMEDLDTNQDNQLSFEECMMLMAKLIFACHEKLHENNPRGHGHSHGKGCGK
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: S100a9 S100 calcium binding protein A9 (calgranulin B) [ Mus musculus ]
• Official Symbol: S100a9
• Synonyms: S100A9; S100 calcium binding protein A9 (calgranulin B); protein S100-A9; MRP-14; calgranulin-B; leukocyte L1 complex heavy chain; migration inhibitory factor-related protein 14; S100 calcium-binding protein A9 (calgranulin B); p14; Cagb; GAGB; L1Ag; BEE22; MRP14; 60B8Ag; AW546964
• Gene ID: 20202
• mRNA Refseq: NM_009114
• Protein Refseq: NP_033140