Recombinant Human S100A9 protein, GST-tagged

• Cat.No.: S100A9-301159H
• Product Overview: Recombinant Human S100A9 (25-114 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Protein length: Lys25-Pro114
• AA Sequence: KLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: S100A9 S100 calcium binding protein A9 [ Homo sapiens ]
• Official Symbol: S100A9
• Synonyms: S100A9; S100 calcium binding protein A9; CAGB, CFAG, S100 calcium binding protein A9 (calgranulin B) , S100 calcium binding protein A9 (calgranulin B); protein S100-A9; 60B8AG; CGLB; LIAG; MAC387; MIF; MRP14; NIF; P14; MRP-14; calgranulin B; calgranulin-B; calprotectin L1H subunit; leukocyte L1 complex heavy chain; migration inhibitory factor-related protein 14; S100 calcium-binding protein A9 (calgranulin B); CAGB; CFAG; L1AG
• Gene ID: 6280
• mRNA Refseq: NM_002965
• Protein Refseq: NP_002956
• MIM: 123886
• UniProt ID: P06702