Recombinant Human S100A7A protein, His-SUMO-tagged

Cat.No. : S100A7A-4590H
Product Overview : Recombinant Human S100A7A protein(Q86SG5)(2-101aa), fused to N-terminal His-SUMO tag, was expressed in E. coli
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 2-101aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 27.2 kDa
AA Sequence : SNTQAERSIIGMIDMFHKYTGRDGKIEKPSLLTMMKENFPNFLSACDKKGIHYLATVFEKKDKNEDKKIDFSEFLSLLGDIAADYHKQSHGAAPCSGGSQ
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name S100A7A S100 calcium binding protein A7A [ Homo sapiens ]
Official Symbol S100A7A
Synonyms S100A7A; S100 calcium binding protein A7A; S100 calcium binding protein A7 like 1 , S100 calcium binding protein A15 , S100A7L1, S100A15; protein S100-A7A; S100A7f; S100 calcium binding protein A15; S100 calcium-binding protein A15; S100 calcium-binding protein A7A; S100 calcium binding protein A7-like 1; S100 calcium-binding protein A7-like 1; NICE-2; S100A15; S100A7L1;
Gene ID 338324
mRNA Refseq NM_176823
Protein Refseq NP_789793
UniProt ID Q86SG5

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All S100A7A Products

Required fields are marked with *

My Review for All S100A7A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon