Recombinant Mouse S100a7a Protein, His-tagged

• Cat.No.: S100a7a-7392M
• Product Overview: Recombinant mouse S100A15 protein, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 1-108
• Description: Biased expression in bladder adult (RPKM 1.5), lung adult (RPKM 0.7) and 13 other tissues
• Form: Liquid
• Molecular Mass: 15 kDa
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMGSHMPDTPVEDSLFQIIHCFHHYAAREGDKETLSLEELKALLLDSVPRFMDTLGRRQPYYITELFRAADKNKDNQICFDEFLYILGKLVKDYHLQFHRQLCAHYCTEHSLY
• Purity: > 85 % by SDS-PAGE
• Stability: Shelf life: one year from despatch.
• Storage: Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
• Concentration: 0.25 mg/mL (determined by Bradford assay)
• Storage Buffer: 20 mM Tris-HCl buffer (pH 8.0) containing 0.15 M NaCl, 20 % glycerol

Gene Information

• Gene Name: S100a7a S100 calcium binding protein A7A [ Mus musculus (house mouse) ]
• Official Symbol: S100a7a
• Synonyms: S100a7a; S100 calcium binding protein A7A; S100A; Gm1020; S100a1; S100A7f; S100a15; AY465109; S100A7L1; S100a15a; S100a17l1; protein S100-A15A; S100 calcium binding protein A15; S100 calcium binding protein A7-like 1; S100 calcium-binding protein A15A
• Gene ID: 381493
• mRNA Refseq: NM_199422
• Protein Refseq: NP_955454
• UniProt ID: Q6S5I3