Recombinant Human S100A5 protein, GST-tagged

• Cat.No.: S100A5-30157H
• Product Overview: Recombinant Human S100A5 (1-110 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Met1-Lys110
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: MPAAWILWAHSHSELHTVMETPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKKELCLGEMKESSIDDLMKSLDKNSDQEIDFKEYSVFLTMLCMAYNDFFLEDNK
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: S100A5 S100 calcium binding protein A5 [ Homo sapiens ]
• Official Symbol: S100A5
• Synonyms: S100A5; S100 calcium binding protein A5; S100 calcium binding protein A5 , S100D; protein S100-A5; S100 calcium-binding protein A5; S100D
• Gene ID: 6276
• mRNA Refseq: NM_002962
• Protein Refseq: NP_002953
• MIM: 176991
• UniProt ID: P33763