Recombinant Human S100A12 Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | S100A12-063H |
Product Overview : | S100A12 MS Standard C13 and N15-labeled recombinant protein (NP_005612) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein is proposed to be involved in specific calcium-dependent signal transduction pathways and its regulatory effect on cytoskeletal components may modulate various neutrophil activities. The protein includes an antimicrobial peptide which has antibacterial activity. |
Molecular Mass : | 10.6 kDa |
AA Sequence : | MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | S100A12 S100 calcium binding protein A12 [ Homo sapiens (human) ] |
Official Symbol | S100A12 |
Synonyms | S100A12; S100 calcium binding protein A12; CAAF1; CAGC; CGRP; ENRAGE; MRP-6; MRP6; p6; protein S100-A12; EN-RAGE; calcitermin; calcium-binding protein in amniotic fluid 1; calgranulin C; extracellular newly identified RAGE-binding protein; migration inhibitory factor-related protein 6; neutrophil S100 protein |
Gene ID | 6283 |
mRNA Refseq | NM_005621 |
Protein Refseq | NP_005612 |
MIM | 603112 |
UniProt ID | P80511 |
◆ Recombinant Proteins | ||
S100A12-2563H | Active Recombinant Human S100A12 protein, His-tagged | +Inquiry |
S100A12-204H | Recombinant Human S100A12, Fc-tagged, C13&N15 Labeled | +Inquiry |
S100A12-6225H | Recombinant Human S100A12 Protein (Met1-Glu92), N-His tagged | +Inquiry |
S100A12-215H | Recombinant Human S100A12, Fc-tagged | +Inquiry |
S100A12-1478C | Recombinant Cattle S100A12 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
S100A12-2094HCL | Recombinant Human S100A12 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All S100A12 Products
Required fields are marked with *
My Review for All S100A12 Products
Required fields are marked with *
0
Inquiry Basket