Recombinant Human S100A12 Protein, MYC/DDK-tagged, C13 and N15-labeled

• Cat.No.: S100A12-063H
• Product Overview: S100A12 MS Standard C13 and N15-labeled recombinant protein (NP_005612) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein is proposed to be involved in specific calcium-dependent signal transduction pathways and its regulatory effect on cytoskeletal components may modulate various neutrophil activities. The protein includes an antimicrobial peptide which has antibacterial activity.
• Molecular Mass: 10.6 kDa
• AA Sequence: MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKETRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: S100A12 S100 calcium binding protein A12 [ Homo sapiens (human) ]
• Official Symbol: S100A12
• Synonyms: S100A12; S100 calcium binding protein A12; CAAF1; CAGC; CGRP; ENRAGE; MRP-6; MRP6; p6; protein S100-A12; EN-RAGE; calcitermin; calcium-binding protein in amniotic fluid 1; calgranulin C; extracellular newly identified RAGE-binding protein; migration inhibitory factor-related protein 6; neutrophil S100 protein
• Gene ID: 6283
• mRNA Refseq: NM_005621
• Protein Refseq: NP_005612
• MIM: 603112
• UniProt ID: P80511