Recombinant Human S100A12 protein, GST-tagged

Cat.No. : S100A12-3460H
Product Overview : Recombinant Human S100A12 protein(P80511)(2-92aa), fused to N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 2-92aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 37.4 kDa
AA Sequence : TKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name S100A12 S100 calcium binding protein A12 [ Homo sapiens ]
Official Symbol S100A12
Synonyms S100A12; S100 calcium binding protein A12; S100 calcium binding protein A12 (calgranulin C) , S100 calcium binding protein A12 (calgranulin C); protein S100-A12; CAAF1; CAGC; CGRP; ENRAGE; MRP6; p6; EN-RAGE; calgranulin C; calgranulin-C; neutrophil S100 protein; calcium-binding protein in amniotic fluid 1; S100 calcium-binding protein A12 (calgranulin C); extracellular newly identified RAGE-binding protein;
Gene ID 6283
mRNA Refseq NM_005621
Protein Refseq NP_005612
MIM 603112
UniProt ID P80511

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All S100A12 Products

Required fields are marked with *

My Review for All S100A12 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon