Recombinant Human S100A12 protein, GST-tagged

• Cat.No.: S100A12-3460H
• Product Overview: Recombinant Human S100A12 protein(P80511)(2-92aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 37.4 kDa
• Protein length: 2-92aa
• AA Sequence: TKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: S100A12 S100 calcium binding protein A12 [ Homo sapiens ]
• Official Symbol: S100A12
• Synonyms: S100A12; S100 calcium binding protein A12; S100 calcium binding protein A12 (calgranulin C) , S100 calcium binding protein A12 (calgranulin C); protein S100-A12; CAAF1; CAGC; CGRP; ENRAGE; MRP6; p6; EN-RAGE; calgranulin C; calgranulin-C; neutrophil S100 protein; calcium-binding protein in amniotic fluid 1; S100 calcium-binding protein A12 (calgranulin C); extracellular newly identified RAGE-binding protein
• Gene ID: 6283
• mRNA Refseq: NM_005621
• Protein Refseq: NP_005612
• MIM: 603112
• UniProt ID: P80511