Recombinant Human RYK

Description :	The protein encoded by this gene is an atypical member of the family of growth factor receptor protein tyrosine kinases, differing from other members at a number of conserved residues in the activation and nucleotide binding domains. This gene product belongs to a subfamily whose members do not appear to be regulated by phosphorylation in the activation segment. It has been suggested that mediation of biological activity by recruitment of a signaling-competent auxiliary protein may occur through an as yet uncharacterized mechanism. Two alternative splice variants have been identified, encoding distinct isoforms.
Protein length :	110 amino acids
Molecular Weight :	37.730kDa inclusive of tags
Source :	Wheat germ
Tissue specificity :	Observed in all the tissues examined.
Form :	Liquid
Purity :	Proprietary Purification
Storage buffer :	pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage :	Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids :	ELQSASAGPSVSLYLSEDEVRRLIGLDAELYYVRNDLISH YALSFSLLVPSETNFLHFTWHAKSKVEYKLGFQVDNVLAM DMPQVNISVQGEVPRTLSVFRVELSCTGKV
Sequence Similarities :	Belongs to the protein kinase superfamily. Tyr protein kinase family.Contains 1 protein kinase domain.Contains 1 WIF domain.
Tag :	Non

Gene Name	RYK RYK receptor-like tyrosine kinase [ Homo sapiens ]
Official Symbol	RYK
Synonyms	RYK; RYK receptor-like tyrosine kinase; JTK5A, JTK5A protein tyrosine kinase; tyrosine-protein kinase RYK; D3S3195; JTK5; RYK1;
Gene ID	6259
mRNA Refseq	NM_002958
Protein Refseq	NP_002949
MIM	600524
Uniprot ID	P34925
Chromosome Location	3q22.1
Pathway	Wnt signaling network, organism-specific biosystem;
Function	ATP binding; Wnt-protein binding; frizzled binding; nucleotide binding; protein binding;