Recombinant Human RUVBL2 Protein, His-SUMO-tagged

• Cat.No.: RUVBL2-1360H
• Product Overview: Recombinant Human RUVBL2 Protein (2-467aa) was expressed in E. coli with N-terminal His-SUMO tag.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 2-467 a.a.
• Description: This gene encodes the second human homologue of the bacterial RuvB gene. Bacterial RuvB protein is a DNA helicase essential for homologous recombination and DNA double-strand break repair. Functional analysis showed that this gene product has both ATPase and DNA helicase activities. This gene is physically linked to the CGB/LHB gene cluster on chromosome 19q13.3, and is very close (55 nt) to the LHB gene, in the opposite orientation.
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 67.0 kDa
• AA Sequence: ATVTATTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELKGETMDTS
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Publications:
  Plasma cells in human pancreatic ductal adenocarcinoma secrete antibodies to self-antigens (2023)

Gene Information

• Gene Name: RUVBL2 RuvB like AAA ATPase 2 [ Homo sapiens (human) ]
• Official Symbol: RUVBL2
• Synonyms: RVB2; TIH2; ECP51; TIP48; CGI-46; ECP-51; INO80J; REPTIN; TIP49B; TAP54-beta; 48 kDa TATA box-binding protein-interacting protein; 48 kDa TBP-interacting protein; 51 kDa erythrocyte cytosolic protein; INO80 complex subunit J; RuvB (E coli homolog)-like 2; TIP60-associated protein 54-beta; erythrocyte cytosolic protein, 51-KD; repressing pontin 52; reptin52 protein
• Gene ID: 10856
• mRNA Refseq: NM_006666.2
• Protein Refseq: NP_006657.1
• UniProt ID: Q9Y230