Recombinant Human RUNX3 protein, His&Myc-tagged

• Cat.No.: RUNX3-3456H
• Product Overview: Recombinant Human RUNX3 protein(Q13761)(1-415aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His&Myc
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 49.4 kDa
• Protein length: 1-415aa
• AA Sequence: MRIPVDPSTSRRFTPPSPAFPCGGGGGKMGENSGALSAQAAVGPGGRARPEVRSMVDVLADHAGELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGDVPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPTQVATYHRAIKVTVDGPREPRRHRQKLEDQTKPFPDRFGDLERLRMRVTPSTPSPRGSLSTTSHFSSQPQTPIQGTSELNPFSDPRQFDRSFPTLPTLTESRFPDPRMHYPGAMSAAFPYSATPSGTSISSLSVAGMPATSRFHHTYLPPPYPGAPQNQSGPFQANPSPYHLYYGTSSGSYQFSMVAGSSSGGDRSPTRMLASCTSSAASVAAGNLMNPSLGGQSDGVEADGSHSNSPTALSTPGRMDEAVWRPY
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: RUNX3 runt-related transcription factor 3 [ Homo sapiens ]
• Official Symbol: RUNX3
• Synonyms: RUNX3; runt-related transcription factor 3; CBFA3; AML2; PEBP2A3; CBF-alpha-3; PEA2 alpha C; PEA2-alpha C; PEBP2 alpha C; PEBP2-alpha C; oncogene AML-2; transcription factor AML2; acute myeloid leukemia gene 2; acute myeloid leukemia 2 protein; core-binding factor subunit alpha-3; SL3-3 enhancer factor 1 alpha C subunit; SL3/AKV core-binding factor alpha C subunit; core-binding factor, runt domain, alpha subunit 3; polyomavirus enhancer-binding protein 2 alpha C subunit; PEBP2aC; FLJ34510; MGC16070
• Gene ID: 864
• mRNA Refseq: NM_001031680
• Protein Refseq: NP_001026850
• MIM: 600210
• UniProt ID: Q13761