Recombinant Human RUNX1T1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: RUNX1T1-701H
• Product Overview: RUNX1T1 MS Standard C13 and N15-labeled recombinant protein (NP_783553) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This gene encodes a member of the myeloid translocation gene family which interact with DNA-bound transcription factors and recruit a range of corepressors to facilitate transcriptional repression. The t(8;21)(q22;q22) translocation is one of the most frequent karyotypic abnormalities in acute myeloid leukemia. The translocation produces a chimeric gene made up of the 5'-region of the runt-related transcription factor 1 gene fused to the 3'-region of this gene. The chimeric protein is thought to associate with the nuclear corepressor/histone deacetylase complex to block hematopoietic differentiation. Alternative splicing results in multiple transcript variants.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 63 kDa
• AA Sequence: MPDSPVDVKTQSRLTPPTMPPPPTTQGAPRTSSFTPTTLTNGTSHSPTALNGAPSPPNGFSNGPSSSSSSSLANQQLPPACGARQLSKLKRFLTTLQQFGNDISPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPFVIPFLKANLPLLQRELLHCARLAKQNPAQYLAQHEQLLLDASTTSPVDSSELLLDVNENGKRRTPDRTKENGFDREPLHSEHPSKRPCTISPGQRYSPNNGLSYQPNGLPHPTPPPPQHYRLDDMAIAHHYRDSYRHPSHRDLRDRNRPMGLHGTRQEEMIDHRLTDREWAEEWKHLDHLLNCIMDMVEKTRRSLTVLRRCQEADREELNYWIRRYSDAEDLKKGGGSSSSHSRQQSPVNPDPVALDAHREFLHRPASGYVPEEIWKKAEEAVNEVKRQAMTELQKAVSEAERKAHDMITTERAKMERTVAEAKRQAAEDALAVINQQEDSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHICGQTLQAQQQGDTPAVSSSVTPNSGAGSPMDTPPAATPRSTTPGTPSTIETTPRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: RUNX1T1 RUNX1 partner transcriptional co-repressor 1 [ Homo sapiens (human) ]
• Official Symbol: RUNX1T1
• Synonyms: RUNX1T1; runt-related transcription factor 1; translocated to, 1 (cyclin D-related); AML1T1, CBFA2T1, core binding factor, runt domain, alpha subunit 2; translocated to, 1; cyclin D related; protein CBFA2T1; CDR; ETO; MTG8; ZMYND2; eight twenty one protein; myeloid translocation gene on 8q22; zinc finger MYND domain-containing protein 2; acute myelogenous leukemia 1 translocation 1, cyclin-D related; core-binding factor, runt domain, alpha subunit 2; translocated to, 1; cyclin D-related; AML1T1; CBFA2T1; MGC2796; FLJ33145; DKFZp564B213
• Gene ID: 862
• mRNA Refseq: NM_175635
• Protein Refseq: NP_783553
• MIM: 133435
• UniProt ID: Q06455