Recombinant Human RTKN, His-tagged

Cat.No. : RTKN-27495TH
Product Overview : Recombinant fragment, corresponding to amino acids 110-405 (296 amino acids) of Human RTKN with an N terminal His tag. Predicted MWt: 33 kDa;
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 110-405 a.a.
Description : This gene encodes a scaffold protein that interacts with GTP-bound Rho proteins. Binding of this protein inhibits the GTPase activity of Rho proteins. This protein may interfere with the conversion of active, GTP-bound Rho to the inactive GDP-bound form by RhoGAP. Rho proteins regulate many important cellular processes, including cytokinesis, transcription, smooth muscle contraction, cell growth and transformation. Dysregulation of the Rho signal transduction pathway has been implicated in many forms of cancer. Alternative splicing results in multiple transcript variants encoding different isoforms.
Conjugation : HIS
Tissue specificity : Highly expressed in prostate, moderately in kidney, heart, brain, spleen, testis, placenta, small intestine, pancreas, skeletal muscle and peripheral blood leukocytes, and weakly in ovary, colon and thymus. Weakly expressed in all normal cell lines tested
Form : Lyophilised:Reconstitution with 159 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : QDTEMILVDRTLTDISFQSNVLFAEAGPDFELRLELYGAC VEEEGALTGGPKRLATKLSSSLGRSSGRRVRASLDSAG GSGSSPILLPTPVVGGPRYHLLAHTTLTLAAVQDGFRT HDLTLASHEENPAWLPLYGSVCCRLAAQPLCMTQPTAS GTLRVQQAGEMQNWAQVHGVLKGTNLFCYRQPEDADTGEE PLLTIAVNKETRVRAGELDQALGRPFTLSISNQYGDDE VTHTLQTESREALQSWMEALWQLFFDMSQWKQCCDEIM KIETPAPRKPPQALAKQGSLYHEMAI
Sequence Similarities : Contains 1 PH domain.Contains 1 REM (Hr1) repeat.
Gene Name RTKN rhotekin [ Homo sapiens ]
Official Symbol RTKN
Synonyms RTKN; rhotekin; B5;
Gene ID 6242
mRNA Refseq NM_001015055
Protein Refseq NP_001015055
MIM 602288
Uniprot ID Q9BST9
Chromosome Location 2p13.1
Pathway Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; G13 Signaling Pathway, organism-specific biosystem;
Function GTP binding; GTP-Rho binding; GTPase inhibitor activity; nucleotide binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All RTKN Products

Required fields are marked with *

My Review for All RTKN Products

Required fields are marked with *

0

Inquiry Basket

cartIcon