Recombinant Human RRN3 protein, GST-tagged

• Cat.No.: RRN3-301172H
• Product Overview: Recombinant Human RRN3 (268-365 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Protein length: Glu268-Gln365
• AA Sequence: ETATQTCGGTDSTEGLFNMDEDEETEHETKAGPERLDQMVHPVAERLDILMSLVLSYMKDVCYVDGKVDNGKTKDLYRDLINIFDKLLLPTHASCHVQ
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: RRN3 RRN3 RNA polymerase I transcription factor homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: RRN3
• Synonyms: RRN3; RRN3 RNA polymerase I transcription factor homolog (S. cerevisiae); RRN3 RNA polymerase I transcription factor homolog (yeast); RNA polymerase I-specific transcription initiation factor RRN3; DKFZp566E104; TIF-IA; transcription initiation factor IA; transcription initiation factor TIF-IA; TIFIA; A-270G1.2; MGC104238
• Gene ID: 54700
• mRNA Refseq: NM_018427
• Protein Refseq: NP_060897
• MIM: 605121
• UniProt ID: Q9NYV6