Recombinant Human RPS4Y1 Protein, His-tagged

Cat.No. : RPS4Y1-451H
Product Overview : Recombinant Human RPS4Y1 Protien(NP_000999)(6-263 aa), fused to His tag, was expressed in E. coli.
Availability April 20, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 6-263 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
AA Sequence : KKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIVFLRNRLKYALTGDEVKKICMQRFIKIDGKVRVDVTYPAGFMDVISIEKTGEHFRLVYDTKGRFAVHRITVEEAKYKLCKVRKITVGVKGIPHLVTHDARTIRYPDPVIKVNDTVQIDLGTGKIINFIKFDTGNLCMVIGGANLGRVGVITNRERHPGSFDVVHVKDANGNSFATRLSNIFVIGNGNKPWISLPRGKGIRLTVAEERDKRLATKQSSG
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).
If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).
Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
Gene Name RPS4Y1 ribosomal protein S4, Y-linked 1 [ Homo sapiens ]
Official Symbol RPS4Y1
Synonyms RPS4Y1; ribosomal protein S4, Y-linked 1; ribosomal protein S4, Y linked , RPS4Y; 40S ribosomal protein S4, Y isoform 1; 40S ribosomal protein S4; Y; MGC5070; MGC119100; ribosomal protein S4Y; S4; 40S ribosomal protein S4, Y; RPS4Y;
Gene ID 6192
mRNA Refseq NM_001008
Protein Refseq NP_000999
MIM 470000
UniProt ID P22090

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All RPS4Y1 Products

Required fields are marked with *

My Review for All RPS4Y1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon