Recombinant Human RPS4Y1 protein(1-263aa), His&Myc-tagged
Cat.No. : | RPS4Y1-8630H |
Product Overview : | Recombinant Human RPS4Y1 protein(P22090)(1-263aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1-263aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 36.9 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIVFLRNRLKYALTGDEVKKICMQRFIKIDGKVRVDVTYPAGFMDVISIEKTGEHFRLVYDTKGRFAVHRITVEEAKYKLCKVRKITVGVKGIPHLVTHDARTIRYPDPVIKVNDTVQIDLGTGKIINFIKFDTGNLCMVIGGANLGRVGVITNRERHPGSFDVVHVKDANGNSFATRLSNIFVIGNGNKPWISLPRGKGIRLTVAEERDKRLATKQSSG |
Gene Name | RPS4Y1 ribosomal protein S4, Y-linked 1 [ Homo sapiens ] |
Official Symbol | RPS4Y1 |
Synonyms | RPS4Y1; ribosomal protein S4, Y-linked 1; ribosomal protein S4, Y linked , RPS4Y; 40S ribosomal protein S4, Y isoform 1; 40S ribosomal protein S4; Y; MGC5070; MGC119100; ribosomal protein S4Y; S4; 40S ribosomal protein S4, Y; RPS4Y; |
Gene ID | 6192 |
mRNA Refseq | NM_001008 |
Protein Refseq | NP_000999 |
MIM | 470000 |
UniProt ID | P22090 |
◆ Recombinant Proteins | ||
RPS4Y1-2430H | Recombinant Human RPS4Y1, GST-tagged | +Inquiry |
RPS4Y1-8630H | Recombinant Human RPS4Y1 protein(1-263aa), His&Myc-tagged | +Inquiry |
RPS4Y1-451H | Recombinant Human RPS4Y1 Protein, His-tagged | +Inquiry |
RPS4Y1-3843R | Recombinant Rhesus Macaque RPS4Y1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RPS4Y1-4026R | Recombinant Rhesus monkey RPS4Y1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPS4Y1-565HCL | Recombinant Human RPS4Y1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RPS4Y1 Products
Required fields are marked with *
My Review for All RPS4Y1 Products
Required fields are marked with *
0
Inquiry Basket