Recombinant Human RPS4Y1 protein(1-263aa), His&Myc-tagged

• Cat.No.: RPS4Y1-8630H
• Product Overview: Recombinant Human RPS4Y1 protein(P22090)(1-263aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli.

Specification

• Source: E.coli
• Species: Human
• Tag: N-His&C-Myc
• Protein length: 1-263aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 36.9 kDa
• AASequence: MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIVFLRNRLKYALTGDEVKKICMQRFIKIDGKVRVDVTYPAGFMDVISIEKTGEHFRLVYDTKGRFAVHRITVEEAKYKLCKVRKITVGVKGIPHLVTHDARTIRYPDPVIKVNDTVQIDLGTGKIINFIKFDTGNLCMVIGGANLGRVGVITNRERHPGSFDVVHVKDANGNSFATRLSNIFVIGNGNKPWISLPRGKGIRLTVAEERDKRLATKQSSG
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: RPS4Y1 ribosomal protein S4, Y-linked 1 [ Homo sapiens ]
• Official Symbol: RPS4Y1
• Synonyms: RPS4Y1; ribosomal protein S4, Y-linked 1; ribosomal protein S4, Y linked , RPS4Y; 40S ribosomal protein S4, Y isoform 1; 40S ribosomal protein S4; Y; MGC5070; MGC119100; ribosomal protein S4Y; S4; 40S ribosomal protein S4, Y; RPS4Y
• Gene ID: 6192
• mRNA Refseq: NM_001008
• Protein Refseq: NP_000999
• MIM: 470000
• UniProt ID: P22090