Recombinant Human RPP25L Protein (1-163 aa), GST-tagged

• Cat.No.: RPP25L-2149H
• Product Overview: Recombinant Human RPP25L Protein (1-163 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-163 aa
• Description: May be a component of ribonuclease P or MRP.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 44.6 kDa
• AA Sequence: MEHYRKAGSVELPAPSPMPQLPPDTLEMRVRDGSKIRNLLGLALGRLEGGSARHVVFSGSGRAAGKAVSCAEIVKRRVPGLHQLTKLRFLQTEDSWVPASPDTGLDPLTVRRHVPAVWVLLSRDPLDPNECGYQPPGAPPGLGSMPSSSCGPRSRRRARDTRS
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: RPP25L ribonuclease P/MRP subunit p25 like [ Homo sapiens (human) ]
• Official Symbol: RPP25L
• Synonyms: RPP25L; C9orf23; bA296L22.5
• Gene ID: 138716
• mRNA Refseq: NM_148178
• Protein Refseq: NP_680544
• UniProt ID: Q8N5L8