Recombinant Full Length Human RPP25L Protein, GST-tagged

• Cat.No.: RPP25L-3850HF
• Product Overview: Human C9orf23 full-length ORF ( NP_680544.1, 1 a.a. - 163 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 163 amino acids
• Description: This gene encodes a protein that appears to belong to a family of evolutionarily related proteins (DUF78), that may share one or more domains in common. Members of this family are small archaebacterial proteins with no known function. Alternative splicing has been observed at this locus and two variants, both encoding the same protein, have been identified. [provided by RefSeq, Jul 2008]
• Molecular Mass: 44 kDa
• AA Sequence: MEHYRKAGSVELPAPSPMPQLPPDTLEMRVRDGSKIRNLLGLALGRLEGGSARHVVFSGSGRAAGKAVSCAEIVKRRVPGLHQLTKLRFLQTEDSWVPASPDTGLDPLTVRRHVPAVWVLLSRDPLDPNECGYQPPGAPPGLGSMPSSSCGPRSRRRARDTRS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: RPP25L ribonuclease P/MRP subunit p25 like [ Homo sapiens (human) ]
• Official Symbol: RPP25L
• Synonyms: C9orf23; RPP25L; ribonuclease P/MRP subunit p25 like; bA296L22.5; ribonuclease P protein subunit p25-like protein; RNase P protein subunit-like p25; alba-like protein C9orf23; ribonuclease P/MRP 25kDa subunit-like; rpp25-like protein
• Gene ID: 138716
• mRNA Refseq: NM_148178
• Protein Refseq: NP_680544
• UniProt ID: Q8N5L8