Recombinant Human RPL13

• Cat.No.: RPL13-31149TH
• Product Overview: Recombinant full length Human RPL13 with N-terminal proprietary tag. Predicted MW 49.32kDa.

Specification

• Description: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L13E family of ribosomal proteins. It is located in the cytoplasm. This gene is expressed at significantly higher levels in benign breast lesions than in breast carcinomas. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
• Protein length: 211 amino acids
• Molecular Weight: 49.320kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Higher levels of expression in benign breast lesions than in carcinomas.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MAPSRNGMVLKPHFHKDWQRRVATWFNQPARKIRRRKARQ AKARHIAPRPASGPIRPIVRCPTVRYHTKVRAGRGFSLEE LRVAGIHKKVARTIGISVDPRRRNKSTESLQANVQRLKEY RSKLILFPRKPSAPKKGDSSAEELKLATQLTGPVMPVRNV YKKEKARVITEEEKNFKAFASLRMARANARLFGIRAKRAK EAAEQDVEKKK
• Sequence Similarities: Belongs to the ribosomal protein L13e family.
• Tag: Non

Gene Information

• Gene Name: RPL13 ribosomal protein L13 [ Homo sapiens ]
• Official Symbol: RPL13
• Synonyms: RPL13; ribosomal protein L13; 60S ribosomal protein L13; BBC1; D16S444E; L13
• Gene ID: 6137
• mRNA Refseq: NM_000977
• Protein Refseq: NP_000968
• MIM: 113703
• Uniprot ID: P26373
• Chromosome Location: 16q24.3
• Pathway: Cap-dependent Translation Initiation, organism-specific biosystem; Cytoplasmic Ribosomal Proteins, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Eukaryotic Translation Elongation, organism-specific biosystem
• Function: RNA binding; protein binding; structural constituent of ribosome