Recombinant Full Length Human RPL13 Protein

• Cat.No.: RPL13-453HF
• Product Overview: Recombinant full length Human RPL13 with N-terminal proprietary tag. Predicted MW 49.32 kDa.

Specification

• Description: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L13E family of ribosomal proteins. It is located in the cytoplasm. This gene is expressed at significantly higher levels in benign breast lesions than in breast carcinomas. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
• Source: In Vitro Cell Free System
• Species: Human
• Form: Liquid
• Molecular Mass: 49.320kDa inclusive of tags
• Protein length: 211 amino acids
• AA Sequence: MAPSRNGMVLKPHFHKDWQRRVATWFNQPARKIRRRKARQ AKARHIAPRPASGPIRPIVRCPTVRYHTKVRAGRGFSLEE LRVAGIHKKVARTIGISVDPRRRNKSTESLQANVQRLKEY RSKLILFPRKPSAPKKGDSSAEELKLATQLTGPVMPVRNV YKKEKARVITEEEKNFKAFASLRMARANARLFGIRAKRAK EAAEQDVEKKK
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: RPL13 ribosomal protein L13 [ Homo sapiens ]
• Official Symbol: RPL13
• Synonyms: RPL13; ribosomal protein L13; 60S ribosomal protein L13; BBC1; D16S444E; L13
• Gene ID: 6137
• mRNA Refseq: NM_000977
• Protein Refseq: NP_000968
• MIM: 113703
• UniProt ID: P26373