Recombinant Human RPL13

Cat.No. : RPL13-30647TH
Product Overview : Recombinant fragment of Human RPL13 with N-terminal proprietary tag. Predicted MW 36.63kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L13E family of ribosomal proteins. It is located in the cytoplasm. This gene is expressed at significantly higher levels in benign breast lesions than in breast carcinomas. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Higher levels of expression in benign breast lesions than in carcinomas.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : ANVQRLKEYRSKLILFPRKPSAPKKGDSSAEELKLATQLTGPVMPVRNVYKKEKARVITEEEKNFKAFASLRMARANARLFGIRAKRAKEAAEQDVEKKK
Sequence Similarities : Belongs to the ribosomal protein L13e family.
Gene Name RPL13 ribosomal protein L13 [ Homo sapiens ]
Official Symbol RPL13
Synonyms RPL13; ribosomal protein L13; 60S ribosomal protein L13; BBC1; D16S444E; L13;
Gene ID 6137
mRNA Refseq NM_000977
Protein Refseq NP_000968
MIM 113703
Uniprot ID P26373
Chromosome Location 16q24.3
Pathway Cap-dependent Translation Initiation, organism-specific biosystem; Cytoplasmic Ribosomal Proteins, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Eukaryotic Translation Elongation, organism-specific biosystem;
Function RNA binding; protein binding; structural constituent of ribosome;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All RPL13 Products

Required fields are marked with *

My Review for All RPL13 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon