Recombinant Human RNF41 protein, T7/His-tagged

• Cat.No.: RNF41-169H
• Product Overview: Recombinant human NRDP1 cDNA (316 aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&T7
• Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
• AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFGYDVTRFQGDVDEDLICPICSGVLEEPVQAPHCEHAFCNACITQWF SQQQTCPVDRSVVTVAHLRPVPRIMRNMLSKLQIACDNAVFGCSAVVRLDNLMSHLSDCEHNPKRPVTCEQGCGL EMPKDELPNHNCIKHLRSVVQQQQTRIAELEKTSAEHKHQLAEQKRDIQLLKAYMRAIRSVNPNLQNLEETIEYN EILEWVNSLQPARVTRWGGMISTPDAVLQAVIKRSLVESGCPASIVNELIENAHERSWPQGLATLETRQMNRRYY ENYVAKRIPGKQAVVVMACENQHMGDDMVQEPGLVMIFAHGVEEI
• Purity: >90% by SDS-PAGE
• Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.

Gene Information

• Gene Name: RNF41 ring finger protein 41 [ Homo sapiens ]
• Official Symbol: RNF41
• Synonyms: RNF41; ring finger protein 41; E3 ubiquitin-protein ligase NRDP1; SBBI03; fetal liver ring finger; neuregulin receptor degradation protein-1; FLRF; NRDP1; MGC45228
• Gene ID: 10193
• mRNA Refseq: NM_001242826
• Protein Refseq: NP_001229755
• UniProt ID: Q9H4P4
• Chromosome Location: 12q13.13
• Pathway: Adaptive Immune System, organism-specific biosystem; Antigen processing: Ubiquitination and Proteasome degradation, organism-specific biosystem; Class I MHC mediated antigen processing & presentation, organism-specific biosystem; Downregulation of ERRB2:ERBB3 signaling, organism-specific biosystem; Endocytosis, organism-specific biosystem
• Function: acid-amino acid ligase activity; ligase activity; metal ion binding; protein binding; protein tag; ubiquitin-protein ligase activity; ubiquitin-protein ligase activity; zinc ion binding