Recombinant Human RNF220 Protein, GST-tagged

• Cat.No.: RNF220-4218H
• Product Overview: Human FLJ10597 partial ORF ( NP_060620, 468 a.a. - 566 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: RNF220 (Ring Finger Protein 220) is a Protein Coding gene. Among its related pathways are Innate Immune System and Class I MHC mediated antigen processing and presentation. GO annotations related to this gene include ligase activity and ubiquitin-protein transferase activity.
• Molecular Mass: 36.63 kDa
• AA Sequence: QEAMQKTCKNSDIEKITEDSAVTTFEALKARVRELERQLSRGDRYKCLICMDSYSMPLTSIQCWHVHCEECWLRTLGAKKLCPQCNTITAPGDLRRIYL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: RNF220 ring finger protein 220 [ Homo sapiens ]
• Official Symbol: RNF220
• Synonyms: RNF220; ring finger protein 220; C1orf164, chromosome 1 open reading frame 164; E3 ubiquitin-protein ligase RNF220; FLJ10597; C1orf164; RP4-678E16.1
• Gene ID: 55182
• mRNA Refseq: NM_018150
• Protein Refseq: NP_060620
• MIM: 616136
• UniProt ID: Q5VTB9